| Clone Name | rbaet49d09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PSAN_MAIZE (O65107) Photosystem I reaction center subunit N, chl... | 59 | 2e-09 | 2 | PSAN_HORVU (P31093) Photosystem I reaction center subunit N, chl... | 58 | 6e-09 | 3 | PSAN_ARATH (P49107) Photosystem I reaction center subunit N, chl... | 52 | 5e-07 | 4 | PSAN_VOLCA (Q9SBN5) Photosystem I reaction center subunit N, chl... | 30 | 2.1 | 5 | YHG3_YEAST (P38756) Protein YHR003C | 28 | 4.7 | 6 | LIFR_RAT (O70535) Leukemia inhibitory factor receptor precursor ... | 28 | 8.0 |
|---|
>PSAN_MAIZE (O65107) Photosystem I reaction center subunit N, chloroplast| precursor (PSI-N) (Fragment) Length = 112 Score = 59.3 bits (142), Expect = 2e-09 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -1 Query: 274 SDDLEIECEGKEKFKCGSNVFWKW 203 SDDLEIECEGKEKFKCGSNVFWKW Sbjct: 89 SDDLEIECEGKEKFKCGSNVFWKW 112
>PSAN_HORVU (P31093) Photosystem I reaction center subunit N, chloroplast| precursor (PSI-N) Length = 145 Score = 58.2 bits (139), Expect = 6e-09 Identities = 23/24 (95%), Positives = 24/24 (100%) Frame = -1 Query: 274 SDDLEIECEGKEKFKCGSNVFWKW 203 +DDLEIECEGKEKFKCGSNVFWKW Sbjct: 122 TDDLEIECEGKEKFKCGSNVFWKW 145
>PSAN_ARATH (P49107) Photosystem I reaction center subunit N, chloroplast| precursor (PSI-N) Length = 171 Score = 51.6 bits (122), Expect = 5e-07 Identities = 18/24 (75%), Positives = 23/24 (95%) Frame = -1 Query: 274 SDDLEIECEGKEKFKCGSNVFWKW 203 S+D+ +ECEGK+K+KCGSNVFWKW Sbjct: 148 SEDIALECEGKDKYKCGSNVFWKW 171
>PSAN_VOLCA (Q9SBN5) Photosystem I reaction center subunit N, chloroplast| precursor (PSI-N) Length = 139 Score = 29.6 bits (65), Expect = 2.1 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = -1 Query: 274 SDDLEIECEGKEKFKCGS 221 ++DL+IECEGK+ CGS Sbjct: 115 AEDLKIECEGKDAKSCGS 132
>YHG3_YEAST (P38756) Protein YHR003C| Length = 429 Score = 28.5 bits (62), Expect = 4.7 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +1 Query: 19 ACWM*QDICRFPLVQLQVKNRIPLDDKITETMTSQPKHL 135 A W+ + +P+ + +VKNR+ D I ET Q L Sbjct: 294 ATWILTKVSGYPMKENEVKNRLKFYDSILETFQKQMARL 332
>LIFR_RAT (O70535) Leukemia inhibitory factor receptor precursor (LIF| receptor) (LIF-R) (CD118 antigen) Length = 1093 Score = 27.7 bits (60), Expect = 8.0 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -1 Query: 238 KFKCGSNVFWKW*SWS 191 + +C S FWKW WS Sbjct: 504 RVRCSSETFWKWSKWS 519 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,246,816 Number of Sequences: 219361 Number of extensions: 553596 Number of successful extensions: 1176 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1153 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1176 length of database: 80,573,946 effective HSP length: 66 effective length of database: 66,096,120 effective search space used: 1586306880 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)