| Clone Name | rbaet49c10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | APLP_MANSE (Q25490) Apolipophorins precursor [Contains: Apolipop... | 28 | 9.0 |
|---|
>APLP_MANSE (Q25490) Apolipophorins precursor [Contains: Apolipophorin-2| (Apolipophorin II) (apoLp-2); Apolipophorin-1 (Apolipophorin I) (apoLp-1)] Length = 3305 Score = 27.7 bits (60), Expect = 9.0 Identities = 15/31 (48%), Positives = 17/31 (54%), Gaps = 6/31 (19%) Frame = +3 Query: 36 KTHPSLSLRYHSPF------LLLQSSKLPST 110 K HP L ++YHSP L LQ S L ST Sbjct: 1873 KAHPVLDIQYHSPSSDKIRRLYLQGSSLSST 1903 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,718,341 Number of Sequences: 219361 Number of extensions: 175275 Number of successful extensions: 709 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 703 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 708 length of database: 80,573,946 effective HSP length: 28 effective length of database: 74,431,838 effective search space used: 1786364112 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)