| Clone Name | rbaet48f08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GFI1_DROME (Q9N658) Zinc finger protein sens (Protein senseless) | 28 | 6.8 | 2 | CAC1C_RABIT (P15381) Voltage-dependent L-type calcium channel al... | 28 | 8.9 |
|---|
>GFI1_DROME (Q9N658) Zinc finger protein sens (Protein senseless)| Length = 541 Score = 28.1 bits (61), Expect = 6.8 Identities = 15/47 (31%), Positives = 24/47 (51%) Frame = -2 Query: 167 HRRPSEQQRVGLRHQLRPRKLNVFSSHPSVHRTRYACVLVRRGSTCS 27 H++P +QQ+ L HQ +P++ H H A + RR S+ S Sbjct: 356 HQQPQQQQQQQLHHQQQPQQ----HQHQQQHPDSTATDVARRSSSSS 398
>CAC1C_RABIT (P15381) Voltage-dependent L-type calcium channel alpha-1C subunit| (Voltage-gated calcium channel alpha subunit Cav1.2) (Calcium channel, L type, alpha-1 polypeptide, isoform 1, cardiac muscle) (Smooth muscle calcium channel blocker receptor) Length = 2171 Score = 27.7 bits (60), Expect = 8.9 Identities = 12/28 (42%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = +2 Query: 11 TQSTCSYTLIHDVQV-HMHISSDGQTDG 91 T+STC T++H+ Q+ H +IS G G Sbjct: 24 TESTCKGTVVHEAQLNHFYISPGGSNYG 51 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 23,428,808 Number of Sequences: 219361 Number of extensions: 342996 Number of successful extensions: 1017 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1012 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1017 length of database: 80,573,946 effective HSP length: 31 effective length of database: 73,773,755 effective search space used: 1770570120 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)