| Clone Name | rbaet48f04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NEP1_NEPGR (Q766C3) Aspartic proteinase nepenthesin-1 precursor ... | 41 | 6e-04 | 2 | NEP2_NEPGR (Q766C2) Aspartic proteinase nepenthesin-2 precursor ... | 37 | 0.015 | 3 | SGS3_DROME (P02840) Salivary glue protein Sgs-3 precursor | 27 | 9.2 | 4 | RGP1_XENLA (O13066) Ran GTPase-activating protein 1 | 27 | 9.2 |
|---|
>NEP1_NEPGR (Q766C3) Aspartic proteinase nepenthesin-1 precursor (EC 3.4.23.-)| (Nepenthesin-I) Length = 437 Score = 41.2 bits (95), Expect = 6e-04 Identities = 27/71 (38%), Positives = 33/71 (46%), Gaps = 4/71 (5%) Frame = -1 Query: 376 IPTVALVFDGGKVVDLDANGIIFGS----CLAFXXXXXXXXXGIIGNVQQRTLEVLYDVG 209 IPT + FDGG + N I S CLA I GN+QQ+ + V+YD G Sbjct: 366 IPTFVMHFDGGDLELPSENYFISPSNGLICLAMGSSSQGMS--IFGNIQQQNMLVVYDTG 423 Query: 208 QSVFGFKSNAC 176 SV F S C Sbjct: 424 NSVVSFASAQC 434
>NEP2_NEPGR (Q766C2) Aspartic proteinase nepenthesin-2 precursor (EC 3.4.23.-)| (Nepenthesin-II) Length = 438 Score = 36.6 bits (83), Expect = 0.015 Identities = 23/74 (31%), Positives = 34/74 (45%), Gaps = 5/74 (6%) Frame = -1 Query: 382 VTIPTVALVFDGGKVVDLDANGIIFGS-----CLAFXXXXXXXXXGIIGNVQQRTLEVLY 218 V +P +++ FDGG V++L I+ CLA I GN+QQ+ +VLY Sbjct: 364 VQVPEISMQFDGG-VLNLGEQNILISPAEGVICLAMGSSSQLGIS-IFGNIQQQETQVLY 421 Query: 217 DVGQSVFGFKSNAC 176 D+ F C Sbjct: 422 DLQNLAVSFVPTQC 435
>SGS3_DROME (P02840) Salivary glue protein Sgs-3 precursor| Length = 307 Score = 27.3 bits (59), Expect = 9.2 Identities = 17/53 (32%), Positives = 23/53 (43%) Frame = +3 Query: 210 PTS*STSRVLCCTXXXXXXXXXXXXXXNARQLPNMIPLASRSTTLPPSNTKAT 368 PT ST++ C T QLP P +++TT P+ TKAT Sbjct: 58 PTQQSTTQPPCTTSKPTTPKQTTT------QLPCTTPTTTKATTTKPTTTKAT 104
>RGP1_XENLA (O13066) Ran GTPase-activating protein 1| Length = 580 Score = 27.3 bits (59), Expect = 9.2 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +2 Query: 107 PS*PPFIPVSRARALSSPGDEQLARVG 187 P+ PP +PV + LS P E+L R+G Sbjct: 417 PASPPKLPVDASTFLSFPSPEKLVRMG 443 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,241,198 Number of Sequences: 219361 Number of extensions: 614099 Number of successful extensions: 1523 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1513 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1523 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 1396778976 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)