| Clone Name | rbaet48a09 |
|---|---|
| Clone Library Name | barley_pub |
>PCDA9_PANTR (Q5DRE3) Protocadherin alpha 9 precursor (PCDH-alpha9)| Length = 950 Score = 30.4 bits (67), Expect = 1.2 Identities = 15/40 (37%), Positives = 27/40 (67%), Gaps = 3/40 (7%) Frame = +3 Query: 93 PQLTRVYIHIYMYMQLCTV---LVYTSI*YTIIQCLSAAP 203 P++T V +++Y+ + +C V LV T + YT+++C SA P Sbjct: 689 PEVTLVDVNVYLIIAICAVSSLLVLTLLLYTVLRC-SAMP 727
>PCDA9_HUMAN (Q9Y5H5) Protocadherin alpha 9 precursor (PCDH-alpha9)| Length = 950 Score = 30.4 bits (67), Expect = 1.2 Identities = 15/40 (37%), Positives = 27/40 (67%), Gaps = 3/40 (7%) Frame = +3 Query: 93 PQLTRVYIHIYMYMQLCTV---LVYTSI*YTIIQCLSAAP 203 P++T V +++Y+ + +C V LV T + YT+++C SA P Sbjct: 689 PEVTLVDVNVYLIIAICAVSSLLVLTLLLYTVLRC-SAMP 727
>SEPT3_MOUSE (Q9Z1S5) Neuronal-specific septin-3| Length = 465 Score = 28.9 bits (63), Expect = 3.5 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 1/53 (1%) Frame = -2 Query: 256 ICYVACV-IYVCMAG*LRCGAADKHCIIVYQILVYTSTVHNCIYIYICMYTRV 101 +C CV +YVCM + C VY ++ ++ V C+ +Y+C+Y+ V Sbjct: 374 VCVCVCVCMYVCMC------VMESAC--VYVCVMESACVCVCMCVYVCVYSGV 418
>ARN_BPT4 (P39510) Anti-restriction endonuclease (Anti-rgl nuclease)| Length = 92 Score = 28.5 bits (62), Expect = 4.6 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +1 Query: 175 QLYNVCPQLHTEVSQPCIHRLHMPHNIFRIRTYLD 279 +LY P L+ + + LH+ +N F I TY D Sbjct: 20 KLYKFLPNLYHSIVNELVEELHLENNDFLIGTYKD 54
>RPOA_EAVBU (P19811) Replicase polyprotein 1ab (ORF1ab polyprotein) [Includes:| Replicase polyprotein 1a (ORF1a)] [Contains: Nsp1 papain-like cysteine proteinase (EC 3.4.22.-) (PCP); Nsp2 cysteine proteinase (EC 3.4.22.-) (CP2) (CP); Nonstructural protein Length = 3175 Score = 28.5 bits (62), Expect = 4.6 Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 3/50 (6%) Frame = -2 Query: 274 GKFVYGICYVACVI---YVCMAG*LRCGAADKHCIIVYQILVYTSTVHNC 134 G ++YGICY V+ + C+ G D C V+ + V T T +C Sbjct: 831 GGWIYGICYFVLVVVSTFTCLPIKCGIGTRDPFCRRVFSVPV-TKTQEHC 879
>HUNB_SCICO (Q01790) Protein hunchback (Fragment)| Length = 50 Score = 28.1 bits (61), Expect = 6.0 Identities = 13/27 (48%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = +1 Query: 67 LKRMLHTQHHNSHVYTYIYICI-CNYA 144 + R + T H SH TY Y C+ CNYA Sbjct: 21 VNRSMLTSHMKSHSNTYPYRCLDCNYA 47
>MC5R_HUMAN (P33032) Melanocortin receptor 5 (MC5-R) (MC-2)| Length = 325 Score = 27.7 bits (60), Expect = 7.8 Identities = 16/53 (30%), Positives = 24/53 (45%) Frame = +1 Query: 19 APYTLHTTITLYCS*LLKRMLHTQHHNSHVYTYIYICICNYARY*YILVFDTQ 177 AP+ LH T+ L C + L+ SH Y+ + +CN I F +Q Sbjct: 252 APFFLHLTLMLSC----PQNLYCSRFMSHFNMYLILIMCNSVMDPLIYAFRSQ 300 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,464,721 Number of Sequences: 219361 Number of extensions: 757716 Number of successful extensions: 1853 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1816 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1851 length of database: 80,573,946 effective HSP length: 71 effective length of database: 64,999,315 effective search space used: 1559983560 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)