| Clone Name | rbaet47g02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CARA_RHILO (Q98IA7) Carbamoyl-phosphate synthase small chain (EC... | 30 | 1.4 | 2 | ARO1_YEAST (P08566) Pentafunctional AROM polypeptide [Includes: ... | 28 | 8.8 |
|---|
>CARA_RHILO (Q98IA7) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 398 Score = 30.4 bits (67), Expect = 1.4 Identities = 17/39 (43%), Positives = 22/39 (56%) Frame = +2 Query: 62 KLTFTAATMYRGGSEKDQWKKKRKELAINGW*DTAAITA 178 K T + YR DQW KKR +A++G DT A+TA Sbjct: 94 KADVTNPSNYRAAGHLDQWLKKRGIVALSGI-DTRALTA 131
>ARO1_YEAST (P08566) Pentafunctional AROM polypeptide [Includes: 3-dehydroquinate| synthase (EC 4.2.3.4); 3-dehydroquinate dehydratase (EC 4.2.1.10) (3-dehydroquinase); Shikimate dehydrogenase (EC 1.1.1.25); Shikimate kinase (EC 2.7.1.71); 3-phosphoshikima Length = 1588 Score = 27.7 bits (60), Expect = 8.8 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = +2 Query: 29 IKTIRK*PDSAKLTFTAATMYRGGSEKDQWKKKRKEL 139 + +RK DS + FT TM +GG+ D+ K +EL Sbjct: 1122 LSILRKATDSIPIIFTVRTMKQGGNFPDEEFKTLREL 1158 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 23,635,494 Number of Sequences: 219361 Number of extensions: 327548 Number of successful extensions: 991 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 986 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 991 length of database: 80,573,946 effective HSP length: 36 effective length of database: 72,676,950 effective search space used: 1744246800 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)