>YJIT_ECOLI (P39391) Hypothetical protein yjiT|
          Length = 521

 Score = 30.4 bits (67), Expect = 1.8
 Identities = 16/64 (25%), Positives = 31/64 (48%)
 Frame = -1

Query: 408 ASVCHRPDQACRVPLCSHFKAKAQTEKADKTWRLLVKKVTRAKVMSSLAERKVVPEVVAE 229
           +++C+R   AC V  CS +  +    +   TW  + KK+  +   + L    +VP+ + +
Sbjct: 74  SNICNRDFAACFVLFCSEWYRRDYERQCGWTWDPIYKKIGISFTATELG--TIVPKGMED 131

Query: 228 SWAR 217
            W R
Sbjct: 132 YWLR 135


  Database: uniprot_sprot.fasta
    Posted date:  May 25, 2006  5:36 PM
  Number of letters in database: 80,573,946
  Number of sequences in database:  219,361
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 52,223,384
Number of Sequences: 219361
Number of extensions: 842173
Number of successful extensions: 1938
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1918
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1938
length of database: 80,573,946
effective HSP length: 100
effective length of database: 58,637,846
effective search space used: 2286875994
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)