ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbaet45f07 |
|---|---|
| Clone Library Name | barley_pub |
>CARA_PORPU (P51201) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 384 Score = 42.0 bits (97), Expect = 4e-04 Identities = 17/26 (65%), Positives = 20/26 (76%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKNNR 210 HPESSPGPHD+D F F+E+MK R Sbjct: 355 HPESSPGPHDADYLFEYFIEIMKQFR 380
>CARA_SYNPX (Q7U7F9) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 383 Score = 41.6 bits (96), Expect = 5e-04 Identities = 17/26 (65%), Positives = 20/26 (76%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKNNR 210 HPE+SPGPHD+D FG FV LM + R Sbjct: 354 HPEASPGPHDADHHFGRFVALMADRR 379
>CARA_SYNEL (Q8DKU5) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 382 Score = 41.6 bits (96), Expect = 5e-04 Identities = 17/26 (65%), Positives = 20/26 (76%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKNNR 210 HPE+SPGPHD+D FGEFV M+ R Sbjct: 350 HPEASPGPHDADYLFGEFVAQMRAYR 375
>CARA_SYNY3 (P74587) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 384 Score = 40.4 bits (93), Expect = 0.001 Identities = 15/26 (57%), Positives = 21/26 (80%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKNNR 210 HPE+SPGPHD+D F +FV+LM+ + Sbjct: 354 HPEASPGPHDADYLFEKFVKLMRQQK 379
>CARA_BUCBP (P59576) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 397 Score = 40.0 bits (92), Expect = 0.002 Identities = 15/25 (60%), Positives = 21/25 (84%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKNN 213 HPE+SPGPHDS + F +F++LMK + Sbjct: 364 HPEASPGPHDSMILFDKFIKLMKKS 388
>CARA_LACPL (P77885) Carbamoyl-phosphate synthase pyrimidine-specific small| chain (EC 6.3.5.5) (Carbamoyl-phosphate synthetase glutamine chain) (CPS-P) Length = 364 Score = 39.3 bits (90), Expect = 0.003 Identities = 14/26 (53%), Positives = 21/26 (80%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKNNR 210 HP+++PGPHD+D F EF++LM N+ Sbjct: 329 HPDAAPGPHDADHIFDEFIDLMAANQ 354
>CARA_BACHD (Q9K9V8) Carbamoyl-phosphate synthase pyrimidine-specific small| chain (EC 6.3.5.5) (Carbamoyl-phosphate synthetase glutamine chain) Length = 362 Score = 39.3 bits (90), Expect = 0.003 Identities = 14/26 (53%), Positives = 22/26 (84%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKNNR 210 HPE+SPGP DS++ F F++LM++N+ Sbjct: 331 HPEASPGPEDSNVLFDRFIKLMESNK 356
>CARA_GRATL (Q6B940) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 395 Score = 38.9 bits (89), Expect = 0.003 Identities = 15/24 (62%), Positives = 19/24 (79%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKN 216 HPE+SPGPHDSD F F+ L+K+ Sbjct: 356 HPEASPGPHDSDYLFKYFINLIKH 379
>CARA_ANASP (Q8YXQ7) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 388 Score = 38.9 bits (89), Expect = 0.003 Identities = 14/26 (53%), Positives = 19/26 (73%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKNNR 210 HPE+SPGPHD+D F +FV M+ + Sbjct: 355 HPEASPGPHDADYLFAQFVHQMRTTK 380
>CARA_CHLTE (Q8KGA2) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 366 Score = 38.1 bits (87), Expect = 0.006 Identities = 15/23 (65%), Positives = 18/23 (78%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMK 219 HPE++PGPHDS F EF ELM+ Sbjct: 340 HPEAAPGPHDSHYLFKEFTELME 362
>CARA_SALTI (Q8Z9L8) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 382 Score = 38.1 bits (87), Expect = 0.006 Identities = 15/26 (57%), Positives = 20/26 (76%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKNNR 210 HPE+SPGPHD+ F F+EL+K+ R Sbjct: 353 HPEASPGPHDAAPLFDHFIELIKHYR 378
>CARA_HELPY (O25835) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 375 Score = 37.7 bits (86), Expect = 0.008 Identities = 16/24 (66%), Positives = 19/24 (79%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKN 216 HPESSPGP +S F EFVEL+K+ Sbjct: 351 HPESSPGPKESHYIFKEFVELLKD 374
>CARA_BIFLO (Q8G816) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 407 Score = 37.7 bits (86), Expect = 0.008 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKNN 213 HPE++ GPHD+ F F ELMKNN Sbjct: 378 HPEAAAGPHDAAYLFDRFCELMKNN 402
>CARA_MYCPA (Q741H2) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 373 Score = 37.4 bits (85), Expect = 0.010 Identities = 13/26 (50%), Positives = 21/26 (80%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKNNR 210 HPE++ GPHD++ F +F+ELM+ +R Sbjct: 348 HPEAAAGPHDANYLFDQFIELMEGDR 373
>CARA_VIBCH (Q9KPH8) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 379 Score = 37.4 bits (85), Expect = 0.010 Identities = 15/26 (57%), Positives = 19/26 (73%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKNNR 210 HPE+SPGPHD+ F F+EL+K R Sbjct: 353 HPEASPGPHDAAPLFDHFIELIKQFR 378
>CARA_VIBVY (Q7MNU1) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 379 Score = 37.0 bits (84), Expect = 0.013 Identities = 14/25 (56%), Positives = 19/25 (76%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKNN 213 HPE+SPGPHD+ F F+EL+K + Sbjct: 353 HPEASPGPHDAAPLFDHFIELIKQH 377
>CARA_VIBVU (Q8DEM1) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 379 Score = 37.0 bits (84), Expect = 0.013 Identities = 14/25 (56%), Positives = 19/25 (76%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKNN 213 HPE+SPGPHD+ F F+EL+K + Sbjct: 353 HPEASPGPHDAAPLFDHFIELIKQH 377
>CARA_VIBPA (Q87SF4) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 379 Score = 37.0 bits (84), Expect = 0.013 Identities = 14/25 (56%), Positives = 19/25 (76%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKNN 213 HPE+SPGPHD+ F F+EL+K + Sbjct: 353 HPEASPGPHDAAPLFDHFIELIKKH 377
>CARA_STRR6 (P63734) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 359 Score = 37.0 bits (84), Expect = 0.013 Identities = 12/23 (52%), Positives = 19/23 (82%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMK 219 HP+++PGPHD+ F EF+E+M+ Sbjct: 331 HPDAAPGPHDASYLFDEFIEMME 353
>CARA_STRPN (P63733) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 359 Score = 37.0 bits (84), Expect = 0.013 Identities = 12/23 (52%), Positives = 19/23 (82%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMK 219 HP+++PGPHD+ F EF+E+M+ Sbjct: 331 HPDAAPGPHDASYLFDEFIEMME 353
>CARA_XYLFT (Q87EB9) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 374 Score = 36.6 bits (83), Expect = 0.017 Identities = 13/22 (59%), Positives = 17/22 (77%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELM 222 HPE+SPGPHD D+ F F+ +M Sbjct: 349 HPEASPGPHDVDVLFDRFITMM 370
>CARA_XYLFA (Q9PEC2) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 374 Score = 36.6 bits (83), Expect = 0.017 Identities = 13/22 (59%), Positives = 17/22 (77%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELM 222 HPE+SPGPHD D+ F F+ +M Sbjct: 349 HPEASPGPHDVDVLFDRFITMM 370
>CARA_LACLC (Q9L4N5) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 357 Score = 36.2 bits (82), Expect = 0.022 Identities = 12/24 (50%), Positives = 19/24 (79%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKN 216 HP+++PGPHD+ F +F++LM N Sbjct: 331 HPDAAPGPHDASYLFDDFMDLMDN 354
>CARA_LACLA (Q9CF80) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 357 Score = 36.2 bits (82), Expect = 0.022 Identities = 12/24 (50%), Positives = 19/24 (79%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKN 216 HP+++PGPHD+ F +F++LM N Sbjct: 331 HPDAAPGPHDASYLFDDFMDLMDN 354
>CARA_AGRT5 (Q8UDF7) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 401 Score = 36.2 bits (82), Expect = 0.022 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKNNR 210 HPE+SPGP DS F FV L++ N+ Sbjct: 368 HPEASPGPQDSHYLFRRFVNLLRENK 393
>CARA_SALTY (P14845) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 382 Score = 36.2 bits (82), Expect = 0.022 Identities = 14/26 (53%), Positives = 19/26 (73%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKNNR 210 HPE+SPGPHD+ F F+EL++ R Sbjct: 353 HPEASPGPHDAAPLFDHFIELIEQYR 378
>CARA_ECOLI (P0A6F1) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 382 Score = 36.2 bits (82), Expect = 0.022 Identities = 14/26 (53%), Positives = 19/26 (73%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKNNR 210 HPE+SPGPHD+ F F+EL++ R Sbjct: 353 HPEASPGPHDAAPLFDHFIELIEQYR 378
>CARA_ECO57 (P0A6F2) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 382 Score = 36.2 bits (82), Expect = 0.022 Identities = 14/26 (53%), Positives = 19/26 (73%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKNNR 210 HPE+SPGPHD+ F F+EL++ R Sbjct: 353 HPEASPGPHDAAPLFDHFIELIEQYR 378
>CARA_THEMA (Q9WZ28) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 392 Score = 35.8 bits (81), Expect = 0.029 Identities = 15/26 (57%), Positives = 18/26 (69%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKNNR 210 HPE+SPGPHD+ F EF L+K R Sbjct: 367 HPEASPGPHDAKYFFEEFKRLIKEVR 392
>CARA_OCEIH (Q8CXH8) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 366 Score = 35.8 bits (81), Expect = 0.029 Identities = 13/27 (48%), Positives = 21/27 (77%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKNNRL 207 HPE+SPGP D++ F EF+ L+K +++ Sbjct: 332 HPEASPGPEDTNFLFDEFLNLIKASKV 358
>CARA_PHOLL (Q7N8W2) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 387 Score = 35.8 bits (81), Expect = 0.029 Identities = 16/31 (51%), Positives = 21/31 (67%), Gaps = 5/31 (16%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELM-----KNNR 210 HPE+SPGPH++ F F+EL+ KNNR Sbjct: 353 HPEASPGPHETASLFDHFIELIEQYCQKNNR 383
>CARA_YERPS (Q66ER8) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 391 Score = 35.4 bits (80), Expect = 0.038 Identities = 14/26 (53%), Positives = 19/26 (73%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKNNR 210 HPE+SPGPHD+ F F+EL++ R Sbjct: 353 HPEASPGPHDAAPLFDHFIELIEAYR 378
>CARA_YERPE (Q8ZIL5) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 391 Score = 35.4 bits (80), Expect = 0.038 Identities = 14/26 (53%), Positives = 19/26 (73%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKNNR 210 HPE+SPGPHD+ F F+EL++ R Sbjct: 353 HPEASPGPHDAAPLFDHFIELIEAYR 378
>CARA_BRAJA (Q89DR8) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 396 Score = 35.4 bits (80), Expect = 0.038 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKNNR 210 HPE+SPGP DS F F ELM+ + Sbjct: 369 HPEASPGPRDSHYLFQRFAELMRQKK 394
>CARA_AQUAE (O66727) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 371 Score = 35.4 bits (80), Expect = 0.038 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVEL 225 HPE+SPGPHDS F EFV++ Sbjct: 348 HPENSPGPHDSYYLFKEFVKM 368
>CARA_WIGBR (Q8D3H7) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 376 Score = 35.4 bits (80), Expect = 0.038 Identities = 15/27 (55%), Positives = 19/27 (70%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKNNRL 207 HPESSPGP D+ F F+ L+K+ RL Sbjct: 347 HPESSPGPKDALFLFKNFINLVKDYRL 373
>CARA_MYCTU (P71811) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 376 Score = 35.4 bits (80), Expect = 0.038 Identities = 13/22 (59%), Positives = 18/22 (81%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELM 222 HPE++ GPHD++ F +FVELM Sbjct: 350 HPEAAAGPHDAEYLFDQFVELM 371
>CARA_MYCLE (Q9CCR3) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 375 Score = 35.4 bits (80), Expect = 0.038 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKNNR 210 HPE++ GPHD++ F FVELM R Sbjct: 350 HPEAAAGPHDAEYLFDSFVELMAAQR 375
>CARA_MYCBO (Q7U055) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 376 Score = 35.4 bits (80), Expect = 0.038 Identities = 13/22 (59%), Positives = 18/22 (81%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELM 222 HPE++ GPHD++ F +FVELM Sbjct: 350 HPEAAAGPHDAEYLFDQFVELM 371
>CARA_CORDI (Q6NH15) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 379 Score = 35.4 bits (80), Expect = 0.038 Identities = 13/26 (50%), Positives = 21/26 (80%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKNNR 210 HPE++ GPHD++ F +FVEL++ N+ Sbjct: 353 HPEAAAGPHDANPLFDQFVELIQANK 378
>CARA_STAES (Q8CPJ5) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 366 Score = 35.0 bits (79), Expect = 0.049 Identities = 13/24 (54%), Positives = 18/24 (75%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKN 216 HPE+ PGP DS+ F EF+ +MK+ Sbjct: 333 HPEARPGPSDSNYLFDEFIAMMKD 356
>CARA_STAEQ (Q5HPY9) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 366 Score = 35.0 bits (79), Expect = 0.049 Identities = 13/24 (54%), Positives = 18/24 (75%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKN 216 HPE+ PGP DS+ F EF+ +MK+ Sbjct: 333 HPEARPGPSDSNYLFDEFITMMKD 356
>CARA_ERWCT (Q6D0C8) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 382 Score = 35.0 bits (79), Expect = 0.049 Identities = 13/26 (50%), Positives = 19/26 (73%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKNNR 210 HPE+SPGPHD+ F F++L++ R Sbjct: 353 HPEASPGPHDAAPLFDHFIDLIQTYR 378
>CARA_STRMU (Q8DUP4) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 362 Score = 35.0 bits (79), Expect = 0.049 Identities = 12/22 (54%), Positives = 18/22 (81%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELM 222 HP+++PGPHD+ F EF+EL+ Sbjct: 331 HPDAAPGPHDASYLFDEFLELI 352
>CARA_BUCAP (Q8K9Z6) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 385 Score = 34.7 bits (78), Expect = 0.064 Identities = 12/22 (54%), Positives = 17/22 (77%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELM 222 HPE+SPGPHD+ F F++L+ Sbjct: 357 HPEASPGPHDASSLFDHFIKLL 378
>CARA_STRP8 (P58894) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 360 Score = 34.7 bits (78), Expect = 0.064 Identities = 12/26 (46%), Positives = 20/26 (76%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKNNR 210 HP+++PGPHD+ F EF+E++ + R Sbjct: 331 HPDAAPGPHDASYLFDEFLEMIDSWR 356
>CARA_STRP6 (Q5XCR8) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 360 Score = 34.7 bits (78), Expect = 0.064 Identities = 12/26 (46%), Positives = 20/26 (76%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKNNR 210 HP+++PGPHD+ F EF+E++ + R Sbjct: 331 HPDAAPGPHDASYLFDEFLEMIDSWR 356
>CARA_STRP3 (P63736) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 360 Score = 34.7 bits (78), Expect = 0.064 Identities = 12/26 (46%), Positives = 20/26 (76%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKNNR 210 HP+++PGPHD+ F EF+E++ + R Sbjct: 331 HPDAAPGPHDASYLFDEFLEMIDSWR 356
>CARA_STRP1 (P63735) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 360 Score = 34.7 bits (78), Expect = 0.064 Identities = 12/26 (46%), Positives = 20/26 (76%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKNNR 210 HP+++PGPHD+ F EF+E++ + R Sbjct: 331 HPDAAPGPHDASYLFDEFLEMIDSWR 356
>CARA_STAAW (P63730) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 366 Score = 34.7 bits (78), Expect = 0.064 Identities = 13/24 (54%), Positives = 18/24 (75%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKN 216 HPE++PGP DS+ F +FV +M N Sbjct: 333 HPEANPGPSDSNYLFDDFVAMMTN 356
>CARA_STAAS (Q6GA11) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 366 Score = 34.7 bits (78), Expect = 0.064 Identities = 13/24 (54%), Positives = 18/24 (75%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKN 216 HPE++PGP DS+ F +FV +M N Sbjct: 333 HPEANPGPSDSNYLFDDFVAMMTN 356
>CARA_STAAR (Q6GHN3) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 366 Score = 34.7 bits (78), Expect = 0.064 Identities = 13/24 (54%), Positives = 18/24 (75%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKN 216 HPE++PGP DS+ F +FV +M N Sbjct: 333 HPEANPGPSDSNYLFDDFVAMMTN 356
>CARA_STAAN (P99147) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 366 Score = 34.7 bits (78), Expect = 0.064 Identities = 13/24 (54%), Positives = 18/24 (75%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKN 216 HPE++PGP DS+ F +FV +M N Sbjct: 333 HPEANPGPSDSNYLFDDFVAMMTN 356
>CARA_STAAM (P63729) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 366 Score = 34.7 bits (78), Expect = 0.064 Identities = 13/24 (54%), Positives = 18/24 (75%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKN 216 HPE++PGP DS+ F +FV +M N Sbjct: 333 HPEANPGPSDSNYLFDDFVAMMTN 356
>CARA_STAAC (Q5HGN0) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 366 Score = 34.7 bits (78), Expect = 0.064 Identities = 13/24 (54%), Positives = 18/24 (75%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKN 216 HPE++PGP DS+ F +FV +M N Sbjct: 333 HPEANPGPSDSNYLFDDFVAMMTN 356
>CARA_HALER (Q8RSS4) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 381 Score = 34.7 bits (78), Expect = 0.064 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKNNR 210 HPE+SPGP D F FVE+M++ R Sbjct: 356 HPEASPGPRDVAPMFDRFVEMMRHRR 381
>CARA_RHOGE (Q9JP87) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 384 Score = 34.7 bits (78), Expect = 0.064 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMK 219 HPE+SPGPHD F FV LM+ Sbjct: 359 HPEASPGPHDIGYLFDRFVALMQ 381
>CARA_RHILO (Q98IA7) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 398 Score = 34.7 bits (78), Expect = 0.064 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKNNR 210 HPE+SPGP DS F FV L++ R Sbjct: 364 HPEASPGPQDSHYLFRRFVNLIREKR 389
>CARA_DEIRA (Q9RWI4) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 394 Score = 34.7 bits (78), Expect = 0.064 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVE 228 HPE+SPGPHDS F F+E Sbjct: 352 HPEASPGPHDSRYLFDRFIE 371
>CARA_ACIAD (Q6F8M7) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 379 Score = 34.3 bits (77), Expect = 0.084 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMK 219 HPE+SPGPHD F F+EL++ Sbjct: 353 HPEASPGPHDCAPLFDHFIELIE 375
>CARA_BUCAI (P57245) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 387 Score = 34.3 bits (77), Expect = 0.084 Identities = 12/26 (46%), Positives = 19/26 (73%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKNNR 210 HPE+SPGPHD+ F F++L+ + + Sbjct: 357 HPEASPGPHDASYLFDYFIKLIVSQK 382
>CARA_CAMJE (Q9PMG8) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 372 Score = 33.9 bits (76), Expect = 0.11 Identities = 14/22 (63%), Positives = 16/22 (72%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELM 222 HPESS GPH+S F EF+ LM Sbjct: 351 HPESSSGPHESKYIFKEFMNLM 372
>CARA_SHEON (Q8EHS6) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 386 Score = 33.9 bits (76), Expect = 0.11 Identities = 13/26 (50%), Positives = 20/26 (76%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKNNR 210 HPE+SPGP+D+ F F+EL+++ R Sbjct: 357 HPEASPGPNDAAPLFDHFIELIEHYR 382
>CARA_STAHJ (Q4L5Q4) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 366 Score = 33.9 bits (76), Expect = 0.11 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMK 219 HPE+ PGP DS+ F EF+ +MK Sbjct: 333 HPEARPGPSDSNYLFDEFMTMMK 355
>CARA_ECOL6 (Q8FLB1) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 382 Score = 33.9 bits (76), Expect = 0.11 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKNNR 210 HPE+SPGPHD+ F F+ L++ R Sbjct: 353 HPEASPGPHDAAPLFDHFIALIEQYR 378
>CARA_FUSNN (Q8RG87) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 358 Score = 33.9 bits (76), Expect = 0.11 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKNN 213 HPE++ GPHD+ F EF++ + NN Sbjct: 332 HPEAAAGPHDTSYLFDEFIKNIDNN 356
>CARA_STRCO (Q9KXR5) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 380 Score = 33.5 bits (75), Expect = 0.14 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKNNR 210 HPE++ GPHD+ F FV LM+ R Sbjct: 354 HPEAAAGPHDAAYLFDRFVNLMEGQR 379
>CARA_STRAW (Q827Q8) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 380 Score = 33.5 bits (75), Expect = 0.14 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKNNR 210 HPE++ GPHD+ F FV LM+ R Sbjct: 354 HPEAAAGPHDAAYLFDRFVSLMEGQR 379
>PYR1_SCHPO (Q09794) Protein ura1 [Includes: Glutamine-dependent| carbamoyl-phosphate synthase (EC 6.3.5.5); Aspartate carbamoyltransferase (EC 2.1.3.2)] Length = 2244 Score = 33.5 bits (75), Expect = 0.14 Identities = 11/25 (44%), Positives = 19/25 (76%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKNN 213 HPES+PGP D++ F F++++K + Sbjct: 422 HPESTPGPRDTEFLFDVFIDVVKRS 446
>CARA_PYRFU (Q8U086) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 371 Score = 33.5 bits (75), Expect = 0.14 Identities = 13/26 (50%), Positives = 19/26 (73%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKNNR 210 HPE+SPGP DS F EFV++++ + Sbjct: 346 HPEASPGPWDSLWVFDEFVKILEGRK 371
>CARA_ZYMMO (O50235) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 374 Score = 33.5 bits (75), Expect = 0.14 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKNNR 210 HPE+SPGP DS F +F++L+ R Sbjct: 348 HPEASPGPQDSYYLFTKFIDLIAKER 373
>CARA_BRUSU (Q8FZJ8) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 407 Score = 33.1 bits (74), Expect = 0.19 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKNNR 210 HPE+SPGP DS F F+ L++ + Sbjct: 370 HPEASPGPQDSHYLFRRFINLIRERK 395
>CARA_BRUME (Q8YIB8) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 407 Score = 33.1 bits (74), Expect = 0.19 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKNNR 210 HPE+SPGP DS F F+ L++ + Sbjct: 370 HPEASPGPQDSHYLFRRFINLIRERK 395
>CARA_HELPJ (Q9ZJY9) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 375 Score = 33.1 bits (74), Expect = 0.19 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMK 219 HPESSPGP +S F EFV L++ Sbjct: 351 HPESSPGPKESHYIFKEFVGLLE 373
>CARA_STRA5 (P63732) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 358 Score = 33.1 bits (74), Expect = 0.19 Identities = 10/22 (45%), Positives = 17/22 (77%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELM 222 HP+++PGPHD+ F EF+ ++ Sbjct: 330 HPDAAPGPHDTSYLFDEFINMI 351
>CARA_STRA3 (P63731) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 358 Score = 33.1 bits (74), Expect = 0.19 Identities = 10/22 (45%), Positives = 17/22 (77%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELM 222 HP+++PGPHD+ F EF+ ++ Sbjct: 330 HPDAAPGPHDTSYLFDEFINMI 351
>CARA_ARCFU (O28995) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 358 Score = 33.1 bits (74), Expect = 0.19 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKNNR 210 HPE+ PGPHD+ F +V++++ R Sbjct: 333 HPEAGPGPHDTYFFFDRYVDMLREYR 358
>CARA_PSEAE (P38098) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 378 Score = 32.7 bits (73), Expect = 0.24 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKNNR 210 HPE+SPGPHD F F+ M R Sbjct: 353 HPEASPGPHDVAPLFDRFISAMAERR 378
>CARA_LISMO (Q8Y664) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 363 Score = 32.7 bits (73), Expect = 0.24 Identities = 12/22 (54%), Positives = 17/22 (77%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELM 222 HPE++PGP D + F EF+E+M Sbjct: 332 HPEANPGPSDVNYLFDEFMEMM 353
>CARA_LISMF (Q71YI0) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 363 Score = 32.7 bits (73), Expect = 0.24 Identities = 12/22 (54%), Positives = 17/22 (77%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELM 222 HPE++PGP D + F EF+E+M Sbjct: 332 HPEANPGPSDVNYLFDEFMEMM 353
>CARA_LISIN (Q92AH2) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 363 Score = 32.7 bits (73), Expect = 0.24 Identities = 12/22 (54%), Positives = 17/22 (77%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELM 222 HPE++PGP D + F EF+E+M Sbjct: 332 HPEANPGPSDVNYLFDEFMEMM 353
>CARA_PHOPR (Q6LUK6) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 384 Score = 32.7 bits (73), Expect = 0.24 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMK 219 HPE+SPGP D+ F F+EL+K Sbjct: 353 HPEASPGPTDAAPLFDHFIELIK 375
>CARA_BACSU (P25993) Carbamoyl-phosphate synthase pyrimidine-specific small| chain (EC 6.3.5.5) (Carbamoyl-phosphate synthetase glutamine chain) Length = 364 Score = 32.3 bits (72), Expect = 0.32 Identities = 11/23 (47%), Positives = 18/23 (78%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMK 219 HPE+SPGP D++ F F+E+++ Sbjct: 329 HPEASPGPEDANHLFDRFIEMIE 351
>CARA_BACCL (P52557) Carbamoyl-phosphate synthase pyrimidine-specific small| chain (EC 6.3.5.5) (Carbamoyl-phosphate synthetase glutamine chain) Length = 364 Score = 32.3 bits (72), Expect = 0.32 Identities = 12/23 (52%), Positives = 18/23 (78%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMK 219 HPE+SPGP D++ F EF+ L++ Sbjct: 331 HPEASPGPEDANPLFDEFLALIR 353
>RPB1_CAEBR (P35074) DNA-directed RNA polymerase II largest subunit (EC 2.7.7.6)| Length = 1853 Score = 32.3 bits (72), Expect = 0.32 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 6/64 (9%) Frame = +2 Query: 110 TPRSSLHGPT------TSQQYRFRNS*WSPSIPTFLPLTICCSSSAPQIHQTPSLSHGAP 271 +P S + PT TS QY + +SPS PT+ P + + ++P+ +P S +P Sbjct: 1725 SPSSPTYSPTSPSYSPTSPQYSPTSPQYSPSSPTYTPSSPTYNPTSPRAFSSPQYSPTSP 1784 Query: 272 GRTP 283 +P Sbjct: 1785 TYSP 1788 Score = 30.8 bits (68), Expect = 0.93 Identities = 21/66 (31%), Positives = 32/66 (48%), Gaps = 3/66 (4%) Frame = +2 Query: 95 TRKIQTPRSSLHGPTTS--QQYRFRNS*WSPSIPTFLPLTICCSSSAPQIHQT-PSLSHG 265 T +P S + PT+ + Y + +SPS PT+ P + S ++PQ T P S Sbjct: 1696 TSPTYSPTSPTYSPTSPSYEGYSPSSPKYSPSSPTYSPTSPSYSPTSPQYSPTSPQYSPS 1755 Query: 266 APGRTP 283 +P TP Sbjct: 1756 SPTYTP 1761 Score = 29.3 bits (64), Expect = 2.7 Identities = 19/58 (32%), Positives = 29/58 (50%) Frame = +2 Query: 110 TPRSSLHGPTTSQQYRFRNS*WSPSIPTFLPLTICCSSSAPQIHQTPSLSHGAPGRTP 283 +P S + PT S QY + ++PS PT+ P + SS +P+ S +P TP Sbjct: 1739 SPTSPQYSPT-SPQYSPSSPTYTPSSPTYNPTSPRAFSSPQYSPTSPTYSPTSPSYTP 1795 Score = 28.9 bits (63), Expect = 3.5 Identities = 17/58 (29%), Positives = 28/58 (48%) Frame = +2 Query: 110 TPRSSLHGPTTSQQYRFRNS*WSPSIPTFLPLTICCSSSAPQIHQTPSLSHGAPGRTP 283 TP S + PT+ + F + +SP+ PT+ P + + S+PQ T +P P Sbjct: 1760 TPSSPTYNPTSPRA--FSSPQYSPTSPTYSPTSPSYTPSSPQYSPTSPTYTPSPADQP 1815 Score = 27.7 bits (60), Expect = 7.8 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +2 Query: 134 PTTSQQYRFRNS*WSPSIPTFLPLTICCSSSAP 232 P TS QY + +SPS PT+ P + S S+P Sbjct: 1815 PGTSNQYSPSSPTYSPSSPTYSPASPSYSPSSP 1847
>CARA_LEPIN (Q8F6R2) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 363 Score = 32.3 bits (72), Expect = 0.32 Identities = 12/26 (46%), Positives = 19/26 (73%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKNNR 210 HPES+PGP+DS F +F +L++ + Sbjct: 336 HPESAPGPNDSRYLFQKFYDLVEKTK 361
>CARA_LEPIC (Q72PK5) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 363 Score = 32.3 bits (72), Expect = 0.32 Identities = 12/26 (46%), Positives = 19/26 (73%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKNNR 210 HPES+PGP+DS F +F +L++ + Sbjct: 336 HPESAPGPNDSRYLFQKFYDLVEKTK 361
>CARA_STAS1 (Q49WY3) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 366 Score = 32.3 bits (72), Expect = 0.32 Identities = 11/22 (50%), Positives = 17/22 (77%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELM 222 HPE+ PGP DS+ F EF++++ Sbjct: 333 HPEACPGPSDSNYLFDEFIDMI 354
>CARA_RHIME (Q92N95) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 401 Score = 32.3 bits (72), Expect = 0.32 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKNNR 210 HPE+SPGP DS F F+ L++ + Sbjct: 368 HPEASPGPQDSHYLFRRFLNLIREKK 393
>PYR1_YEAST (P07259) Protein URA1 [Includes: Glutamine-dependent| carbamoyl-phosphate synthase (EC 6.3.5.5); Aspartate carbamoyltransferase (EC 2.1.3.2)] Length = 2214 Score = 32.3 bits (72), Expect = 0.32 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMK 219 HPES+PGP D++ F F++ +K Sbjct: 386 HPESTPGPRDTEFLFDVFIQAVK 408
>CARX_BACST (P54324) Carbamoyl-phosphate synthase arginine-specific small chain| (EC 6.3.5.5) (Carbamoyl-phosphate synthetase glutamine chain) Length = 354 Score = 32.0 bits (71), Expect = 0.42 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVE 228 HPE+ PGPHD+ F EF++ Sbjct: 325 HPEAHPGPHDTGYIFDEFLQ 344
>CARA_THEVO (Q97AJ4) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 345 Score = 32.0 bits (71), Expect = 0.42 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGE 237 HPE+SPGPHD+ FGE Sbjct: 321 HPEASPGPHDTRWFFGE 337
>CARA_CYACA (O19886) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 399 Score = 31.6 bits (70), Expect = 0.54 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKNNR 210 HPE SPGPHDS+ F +V ++ ++ Sbjct: 372 HPEGSPGPHDSNYLFKYWVYIIYKSK 397
>CARA_XANAC (P58895) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 391 Score = 31.6 bits (70), Expect = 0.54 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELM 222 HPE+SPGP D F FV+LM Sbjct: 366 HPEASPGPRDVGPLFDRFVDLM 387
>PYR1_EMENI (O93937) Protein pyrABCN [Includes: Glutamine-dependent| carbamoyl-phosphate (EC 6.3.5.5); Aspartate carbamoyltransferase (EC 2.1.3.2)] Length = 2275 Score = 31.6 bits (70), Expect = 0.54 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKN 216 HPES+PGP D++ F F+ +K+ Sbjct: 426 HPESTPGPRDTEYLFDVFINAIKD 449
>CARA_RALSO (Q8XZ85) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 378 Score = 31.2 bits (69), Expect = 0.71 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKNNR 210 HPE+SPGPHD F F M + Sbjct: 352 HPEASPGPHDIGYLFDRFTAAMAERK 377
>CARA_METJA (Q58425) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 354 Score = 31.2 bits (69), Expect = 0.71 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVEL 225 HPE+ PGPHD+ F E ++L Sbjct: 330 HPEARPGPHDTMFLFDEMIKL 350
>CARA_CORGL (P58893) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 393 Score = 31.2 bits (69), Expect = 0.71 Identities = 12/22 (54%), Positives = 17/22 (77%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELM 222 HPE++ GP+D+ F +FVELM Sbjct: 363 HPEAAAGPNDASPLFDQFVELM 384
>CARA_PYRAE (Q8ZY49) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 346 Score = 31.2 bits (69), Expect = 0.71 Identities = 11/25 (44%), Positives = 19/25 (76%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKNN 213 HPE+SPGP D+ F +F++L++ + Sbjct: 320 HPEASPGPQDTRWVFDKFLKLVERH 344
>RPB1_CAEEL (P16356) DNA-directed RNA polymerase II largest subunit (EC 2.7.7.6)| Length = 1852 Score = 31.2 bits (69), Expect = 0.71 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 6/64 (9%) Frame = +2 Query: 110 TPRSSLHGPT------TSQQYRFRNS*WSPSIPTFLPLTICCSSSAPQIHQTPSLSHGAP 271 +P S + PT TS QY + +SPS PT+ P + + ++P+ +P S +P Sbjct: 1724 SPSSPTYSPTSPSYSPTSPQYSPTSPQYSPSSPTYTPSSPTYNPTSPRGFSSPQYSPTSP 1783 Query: 272 GRTP 283 +P Sbjct: 1784 TYSP 1787 Score = 29.3 bits (64), Expect = 2.7 Identities = 17/58 (29%), Positives = 28/58 (48%) Frame = +2 Query: 110 TPRSSLHGPTTSQQYRFRNS*WSPSIPTFLPLTICCSSSAPQIHQTPSLSHGAPGRTP 283 TP S + PT+ + F + +SP+ PT+ P + + S+PQ T +P P Sbjct: 1759 TPSSPTYNPTSPRG--FSSPQYSPTSPTYSPTSPSYTPSSPQYSPTSPTYTPSPSEQP 1814 Score = 29.3 bits (64), Expect = 2.7 Identities = 21/69 (30%), Positives = 31/69 (44%), Gaps = 6/69 (8%) Frame = +2 Query: 95 TRKIQTPRSSLHGPTTSQQ-----YRFRNS*WSPSIPTFLPLTICCSSSAPQIHQT-PSL 256 T +P S + PT+ Y + +SPS PT+ P + S ++PQ T P Sbjct: 1692 TSPTYSPTSPTYSPTSPSYESGGGYSPSSPKYSPSSPTYSPTSPSYSPTSPQYSPTSPQY 1751 Query: 257 SHGAPGRTP 283 S +P TP Sbjct: 1752 SPSSPTYTP 1760 Score = 28.1 bits (61), Expect = 6.0 Identities = 19/58 (32%), Positives = 29/58 (50%) Frame = +2 Query: 110 TPRSSLHGPTTSQQYRFRNS*WSPSIPTFLPLTICCSSSAPQIHQTPSLSHGAPGRTP 283 +P S + PT S QY + ++PS PT+ P + SS +P+ S +P TP Sbjct: 1738 SPTSPQYSPT-SPQYSPSSPTYTPSSPTYNPTSPRGFSSPQYSPTSPTYSPTSPSYTP 1794 Score = 27.7 bits (60), Expect = 7.8 Identities = 18/46 (39%), Positives = 23/46 (50%) Frame = +2 Query: 95 TRKIQTPRSSLHGPTTSQQYRFRNS*WSPSIPTFLPLTICCSSSAP 232 T TP S P TS QY + +SPS PT+ P + S S+P Sbjct: 1802 TSPTYTPSPS-EQPGTSAQYSPTSPTYSPSSPTYSPASPSYSPSSP 1846
>CPSM_RAT (P07756) Carbamoyl-phosphate synthase [ammonia], mitochondrial| precursor (EC 6.3.4.16) (Carbamoyl-phosphate synthetase I) (CPSase I) Length = 1500 Score = 31.2 bits (69), Expect = 0.71 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKNNR 210 HPE SPGP D++ F F L+K + Sbjct: 377 HPEVSPGPTDTEYLFDSFFSLIKKGK 402
>CPSM_MOUSE (Q8C196) Carbamoyl-phosphate synthase [ammonia], mitochondrial| precursor (EC 6.3.4.16) (Carbamoyl-phosphate synthetase I) (CPSase I) Length = 1500 Score = 31.2 bits (69), Expect = 0.71 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKNNR 210 HPE SPGP D++ F F L+K + Sbjct: 377 HPEVSPGPTDTEYLFDSFFSLIKKGK 402
>CARA_PSESM (Q87WP3) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 378 Score = 30.8 bits (68), Expect = 0.93 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKNNR 210 HPE+SPGP+D F F++ M R Sbjct: 353 HPEASPGPNDVAPLFDRFIDAMAKRR 378
>CARA_PASMU (Q9CKV3) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 385 Score = 30.4 bits (67), Expect = 1.2 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKNNRL 207 HPE+SPGP+D F +F+ M+ L Sbjct: 349 HPEASPGPNDVAYLFDKFINEMRKANL 375
>CARA_HELHP (Q7VHS5) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 378 Score = 30.4 bits (67), Expect = 1.2 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVEL 225 HPE+SPGP ++ + F EF +L Sbjct: 355 HPEASPGPREARILFEEFAKL 375
>CARA_CLOPE (Q8XHB2) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 349 Score = 30.4 bits (67), Expect = 1.2 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVE 228 HPE+ PGP DS+ F EF++ Sbjct: 327 HPEACPGPKDSEYIFDEFMK 346
>CARA_THET2 (Q72GZ0) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 391 Score = 30.4 bits (67), Expect = 1.2 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVE 228 HPE++PGPHD+ F F+E Sbjct: 349 HPEAAPGPHDALYLFRRFLE 368
>RS19_MYCTU (P0A5X4) 30S ribosomal protein S19| Length = 93 Score = 30.4 bits (67), Expect = 1.2 Identities = 19/61 (31%), Positives = 32/61 (52%) Frame = +3 Query: 57 LLYRCSSADKRNQQERSKLLGARCTVQQQANSTGFATHDGRQASQPFFHSQSVVLHQLHK 236 LL + +++N ++ K R T+ FA HDGR+ P F ++S+V H+L + Sbjct: 15 LLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFAVHDGRK-HVPVFVTESMVGHKLGE 73 Query: 237 F 239 F Sbjct: 74 F 74
>RS19_MYCPA (Q73SB0) 30S ribosomal protein S19| Length = 93 Score = 30.4 bits (67), Expect = 1.2 Identities = 18/61 (29%), Positives = 33/61 (54%) Frame = +3 Query: 57 LLYRCSSADKRNQQERSKLLGARCTVQQQANSTGFATHDGRQASQPFFHSQSVVLHQLHK 236 LL + + +++N ++ K R T+ FA HDGR+ P F ++++V H+L + Sbjct: 15 LLKKVDAQNEKNTKQVIKTWSRRSTIIPDFIGHTFAVHDGRK-HVPVFVTEAMVGHKLGE 73 Query: 237 F 239 F Sbjct: 74 F 74
>RS19_MYCBO (P0A5X5) 30S ribosomal protein S19| Length = 93 Score = 30.4 bits (67), Expect = 1.2 Identities = 19/61 (31%), Positives = 32/61 (52%) Frame = +3 Query: 57 LLYRCSSADKRNQQERSKLLGARCTVQQQANSTGFATHDGRQASQPFFHSQSVVLHQLHK 236 LL + +++N ++ K R T+ FA HDGR+ P F ++S+V H+L + Sbjct: 15 LLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFAVHDGRK-HVPVFVTESMVGHKLGE 73 Query: 237 F 239 F Sbjct: 74 F 74
>CPSM_RANCA (Q91293) Carbamoyl-phosphate synthase [ammonia], mitochondrial| precursor (EC 6.3.4.16) (Carbamoyl-phosphate synthetase I) (CPSase I) Length = 1496 Score = 30.0 bits (66), Expect = 1.6 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKNNR 210 HPE++PGP D++ F ++ L+K + Sbjct: 374 HPEANPGPVDTEFLFDVYMSLIKKGK 399
>CARA_NEIMB (Q9JXX4) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 377 Score = 30.0 bits (66), Expect = 1.6 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMK 219 HPE+SPGP D F +F+ MK Sbjct: 350 HPEASPGPQDVGYLFDKFIGNMK 372
>CARA_NEIMA (Q9JVZ6) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 377 Score = 30.0 bits (66), Expect = 1.6 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMK 219 HPE+SPGP D F +F+ MK Sbjct: 350 HPEASPGPQDVGYLFDKFIGNMK 372
>CARX_BACHD (Q9K8V6) Carbamoyl-phosphate synthase arginine-specific small chain| (EC 6.3.5.5) (Carbamoyl-phosphate synthetase glutamine chain) Length = 359 Score = 30.0 bits (66), Expect = 1.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVE 228 HPE+ PGP DSD F F++ Sbjct: 328 HPEAHPGPSDSDEIFHSFID 347
>VE1_HPV15 (Q05135) Replication protein E1 (EC 3.6.1.-) (ATP-dependent| helicase E1) Length = 602 Score = 29.6 bits (65), Expect = 2.1 Identities = 15/46 (32%), Positives = 26/46 (56%) Frame = +1 Query: 151 VQVSQLMMVAKHPNLSSTHNLLFFISSTNSPNAKSESWGPGEDSGW 288 +QVS++ ++A+ P L ST + LF+ + +PN + GE W Sbjct: 250 LQVSEIQIIAEPPKLRSTLSALFWYKGSMNPNV----YAHGEYPEW 291
>CPSM_HUMAN (P31327) Carbamoyl-phosphate synthase [ammonia], mitochondrial| precursor (EC 6.3.4.16) (Carbamoyl-phosphate synthetase I) (CPSase I) Length = 1500 Score = 29.6 bits (65), Expect = 2.1 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKNNR 210 HPE +PGP D++ F F L+K + Sbjct: 377 HPEVTPGPIDTEYLFDSFFSLIKKGK 402
>CARA_THEAC (Q9HK16) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 348 Score = 29.6 bits (65), Expect = 2.1 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGE 237 HPE+SPGPHD+ F E Sbjct: 321 HPEASPGPHDTRWFFSE 337
>CARA_CLOAB (Q97FT2) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 351 Score = 29.3 bits (64), Expect = 2.7 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVEL 225 HPE +PGP D+ F +FV L Sbjct: 331 HPEGAPGPTDTTYLFDQFVNL 351
>RPB1_DROME (P04052) DNA-directed RNA polymerase II largest subunit (EC 2.7.7.6)| Length = 1887 Score = 29.3 bits (64), Expect = 2.7 Identities = 17/60 (28%), Positives = 29/60 (48%) Frame = +2 Query: 110 TPRSSLHGPTTSQQYRFRNS*WSPSIPTFLPLTICCSSSAPQIHQTPSLSHGAPGRTPDG 289 +P S + PT S Y + +SP+ P + P+T S ++P +P S +P + G Sbjct: 1693 SPSSPSYSPT-SPCYSPTSPSYSPTSPNYTPVTPSYSPTSPNYSASPQYSPASPAYSQTG 1751
>RPB1_ARATH (P18616) DNA-directed RNA polymerase II largest subunit (EC 2.7.7.6)| Length = 1840 Score = 29.3 bits (64), Expect = 2.7 Identities = 18/58 (31%), Positives = 28/58 (48%) Frame = +2 Query: 110 TPRSSLHGPTTSQQYRFRNS*WSPSIPTFLPLTICCSSSAPQIHQTPSLSHGAPGRTP 283 +P S + PT S Y + +SPS PT+ P + S ++P + S PG +P Sbjct: 1754 SPTSPNYSPT-SPSYSPTSPSYSPSSPTYSPSSPYSSGASPDYSPSAGYSPTLPGYSP 1810
>CARA_CAUCR (Q9A4J7) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 388 Score = 29.3 bits (64), Expect = 2.7 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELM 222 HPE+SPGP DS F F LM Sbjct: 363 HPEASPGPTDSLYLFERFAGLM 384
>CARA_RHOBA (Q7UGJ6) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 389 Score = 29.3 bits (64), Expect = 2.7 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVE 228 HPE++ GPHDS F F E Sbjct: 360 HPEAAAGPHDSHYLFSRFQE 379
>RS19_MYCLE (O32985) 30S ribosomal protein S19| Length = 93 Score = 29.3 bits (64), Expect = 2.7 Identities = 18/61 (29%), Positives = 32/61 (52%) Frame = +3 Query: 57 LLYRCSSADKRNQQERSKLLGARCTVQQQANSTGFATHDGRQASQPFFHSQSVVLHQLHK 236 LL + +++N ++ K R T+ FA HDGR+ P F ++++V H+L + Sbjct: 15 LLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFAVHDGRK-HVPVFVTEAMVGHKLGE 73 Query: 237 F 239 F Sbjct: 74 F 74
>MANC7_ECOLI (P37741) Mannose-1-phosphate guanylyltransferase [GDP] (EC| 2.7.7.22) (GDP-mannose pyrophosphorylase) (GMP) Length = 464 Score = 29.3 bits (64), Expect = 2.7 Identities = 13/41 (31%), Positives = 22/41 (53%) Frame = +1 Query: 70 VVQLIREINKKDPNSSELAARSNNKPTVQVSQLMMVAKHPN 192 V + +R +NK D N + N P + ++ L++ KHPN Sbjct: 67 VAEQLRHLNKLDNNIILEPSGRNTAPAICIAALILKMKHPN 107
>SAS2_YEAST (P40963) Histone acetyltransferase SAS2 (EC 2.3.1.48) (Something| about silencing protein 2) Length = 338 Score = 29.3 bits (64), Expect = 2.7 Identities = 15/41 (36%), Positives = 24/41 (58%) Frame = -2 Query: 171 HELRNLYCWLVVGPCSELRGVWIFLVDFSYQLNYTYKVTSG 49 ++ NL C L+ P RG+ + L++FSY+L+ V SG Sbjct: 201 YQQNNLACILIFPPYQR-RGLGLLLIEFSYKLSQLEGVISG 240
>CARA_METKA (Q8TY15) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 361 Score = 28.9 bits (63), Expect = 3.5 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKNN 213 HPE+ PGP D+ F EF+ + + + Sbjct: 337 HPEAGPGPWDTKWVFDEFLAMCREH 361
>CARA_COREF (Q8FT41) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 400 Score = 28.9 bits (63), Expect = 3.5 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELM 222 HPE++ GP+D+ F +FV LM Sbjct: 368 HPEAAAGPNDASPLFDQFVALM 389
>RS19_CORDI (Q6NJD1) 30S ribosomal protein S19| Length = 92 Score = 28.5 bits (62), Expect = 4.6 Identities = 18/61 (29%), Positives = 30/61 (49%) Frame = +3 Query: 57 LLYRCSSADKRNQQERSKLLGARCTVQQQANSTGFATHDGRQASQPFFHSQSVVLHQLHK 236 LL + + +++ ++ K R T+ FA HDGR+ P F S+V H+L + Sbjct: 15 LLNKVDAQNEKGTKQVIKTWSRRSTILPDFIGHTFAVHDGRK-HVPVFVDDSMVGHKLGE 73 Query: 237 F 239 F Sbjct: 74 F 74
>CARA_PSEPK (Q88DU5) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 378 Score = 28.5 bits (62), Expect = 4.6 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKNNR 210 HPE+SPGP D F F + M R Sbjct: 353 HPEASPGPTDVAPLFDRFTDAMAKRR 378
>CARA_BACHK (Q6HES7) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 365 Score = 28.5 bits (62), Expect = 4.6 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKN 216 HPE+S GP D++ F +F+ +++N Sbjct: 330 HPEASAGPEDANDLFEDFLTMIEN 353
>CARA_BACCZ (Q636D9) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 365 Score = 28.5 bits (62), Expect = 4.6 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKN 216 HPE+S GP D++ F +F+ +++N Sbjct: 330 HPEASAGPEDANDLFEDFLTMIEN 353
>CARA_BACCR (Q819S2) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 365 Score = 28.5 bits (62), Expect = 4.6 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKN 216 HPE+S GP D++ F +F+ +++N Sbjct: 330 HPEASAGPEDANDLFEDFLTMIEN 353
>CARA_BACC1 (Q732I2) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 365 Score = 28.5 bits (62), Expect = 4.6 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKN 216 HPE+S GP D++ F +F+ +++N Sbjct: 330 HPEASAGPEDANDLFEDFLTMIEN 353
>CARA_BACAN (Q81WF1) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 365 Score = 28.5 bits (62), Expect = 4.6 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELMKN 216 HPE+S GP D++ F +F+ +++N Sbjct: 330 HPEASAGPEDANDLFEDFLTMIEN 353
>CARA_THETN (Q8RBK1) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 356 Score = 28.5 bits (62), Expect = 4.6 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELM 222 HPE+ PGP DS F +F++++ Sbjct: 323 HPEACPGPRDSTDIFDKFMDIV 344
>TFE2_HUMAN (P15923) Transcription factor E2-alpha (Immunoglobulin| enhancer-binding factor E12/E47) (Transcription factor 3) (TCF-3) (Immunoglobulin transcription factor 1) (Transcription factor ITF-1) (Kappa-E2-binding factor) Length = 654 Score = 28.5 bits (62), Expect = 4.6 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 2/58 (3%) Frame = +1 Query: 43 YNTTSYFIGVVQLIREINKKDPNSSELAARSNNKPTVQVS--QLMMVAKHPNLSSTHN 210 + S + + Q +RE N +P ++ L R K + V Q+++ A HP LS HN Sbjct: 593 HQAVSVILNLEQQVRERNL-NPKAACLKRREEEKVSGVVGDPQMVLSAPHPGLSEAHN 649
>PARM1_RAT (Q6P9X9) Protein PARM-1 precursor (Prostatic androgen-repressed| message 1 protein) (Castration-induced prostatic apoptosis-related protein 1) (CIPAR-1) Length = 296 Score = 28.5 bits (62), Expect = 4.6 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +2 Query: 188 PTFLPLTICCSSSAPQIHQTPSLSHGAPGRTP 283 PT LP+++ S+AP T S H A TP Sbjct: 24 PTLLPVSLTTKSTAPMATWTTSAQHTAMATTP 55
>CARA_XANCP (P58896) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 375 Score = 28.1 bits (61), Expect = 6.0 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEFVELM 222 HPE+SPGP D F FV M Sbjct: 349 HPEASPGPRDVGPLFDRFVASM 370
>4CL1_ORYSA (P17814) 4-coumarate--CoA ligase 1 (EC 6.2.1.12) (4CL 1)| (4-coumaroyl-CoA synthase 1) Length = 564 Score = 27.7 bits (60), Expect = 7.8 Identities = 17/56 (30%), Positives = 23/56 (41%) Frame = +2 Query: 107 QTPRSSLHGPTTSQQYRFRNS*WSPSIPTFLPLTICCSSSAPQIHQTPSLSHGAPG 274 Q P S+ S + FR+ +I LPL C P++ P L GA G Sbjct: 7 QQPESAAPATEASPEIIFRSKLQDIAITNTLPLHRYCFERLPEVAARPCLIDGATG 62
>FAD3C_BRANA (P48618) Omega-3 fatty acid desaturase, chloroplast precursor (EC| 1.14.19.-) (Fragment) Length = 404 Score = 27.7 bits (60), Expect = 7.8 Identities = 16/48 (33%), Positives = 26/48 (54%) Frame = +2 Query: 140 TSQQYRFRNS*WSPSIPTFLPLTICCSSSAPQIHQTPSLSHGAPGRTP 283 +S ++R + W+ ++ T PLT+ SSS+P I + P PG P Sbjct: 8 SSPRFRLNSRNWALNVTT--PLTVD-SSSSPPIEEEPKTQRFDPGAPP 52
>CARA_DESVM (Q8KZA0) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 376 Score = 27.7 bits (60), Expect = 7.8 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -3 Query: 287 HPESSPGPHDSDLAFGEF 234 HPE+SPGP DS F F Sbjct: 349 HPEASPGPTDSRYFFARF 366
>RPB1_DICDI (P35084) DNA-directed RNA polymerase II largest subunit (EC 2.7.7.6)| (Fragment) Length = 902 Score = 27.7 bits (60), Expect = 7.8 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Frame = +2 Query: 110 TPRSSLHGPTTSQQYRFRNS*WSPSIPTFLPLTICCSSSAPQIH-QTPSLSHGAPGRTP 283 +P S + PT S Y + +SP+ P++ P + S S+P +PS S +P +P Sbjct: 827 SPTSPSYSPT-SPSYSPTSPSYSPTSPSYSPTSPSYSPSSPSYSPSSPSYSPSSPSYSP 884
>C22AA_BACTU (P56957) Pesticidal crystal protein cry22Aa (Insecticidal| delta-endotoxin CryXXIIA(a)) (Crystaline entomocidal protoxin) (79 kDa crystal protein) Length = 722 Score = 27.7 bits (60), Expect = 7.8 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -1 Query: 289 TIRSPPRGPMTQTWRLVN 236 T+ PR P T TWRLVN Sbjct: 206 TVGEKPRTPRTATWRLVN 223
>CADN_DROME (O15943) Neural-cadherin precursor (Cadherin-N protein)| (DN-cadherin) Length = 3097 Score = 27.7 bits (60), Expect = 7.8 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = +1 Query: 163 QLMMVAKHPNLSSTHNLLFFISSTN 237 QL++V + PN ++THNL F+ N Sbjct: 141 QLVVVEQTPNATNTHNLQLFVMHRN 165
>INO80_NEUCR (Q872I5) Putative DNA helicase ino-80 (EC 3.6.1.-)| Length = 2001 Score = 27.7 bits (60), Expect = 7.8 Identities = 18/57 (31%), Positives = 28/57 (49%) Frame = +2 Query: 113 PRSSLHGPTTSQQYRFRNS*WSPSIPTFLPLTICCSSSAPQIHQTPSLSHGAPGRTP 283 PRS L+ PT SQQ++ ++ +P + ++SAP + PS P TP Sbjct: 166 PRSILNPPTPSQQHQQQHHHPNPFV----------AASAPSLPPPPSSLQAPPAITP 212 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.315 0.129 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,068,373 Number of Sequences: 219361 Number of extensions: 899863 Number of successful extensions: 2835 Number of sequences better than 10.0: 145 Number of HSP's better than 10.0 without gapping: 2697 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2826 length of database: 80,573,946 effective HSP length: 71 effective length of database: 64,999,315 effective search space used: 1559983560 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits)
