| Clone Name | rbaet44h11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | DHX8_HUMAN (Q14562) ATP-dependent RNA helicase DHX8 (EC 3.6.1.-)... | 29 | 3.0 | 2 | ATG3_EMENI (Q5AVG2) Autophagy-related protein 3 (Autophagy-relat... | 29 | 3.0 | 3 | Y4GI_RHISN (P55465) Hypothetical protein y4gI | 28 | 6.8 | 4 | MOG5_CAEEL (Q09530) Probable pre-mRNA-splicing factor ATP-depend... | 28 | 8.8 |
|---|
>DHX8_HUMAN (Q14562) ATP-dependent RNA helicase DHX8 (EC 3.6.1.-) (DEAH box| protein 8) (RNA helicase HRH1) Length = 1220 Score = 29.3 bits (64), Expect = 3.0 Identities = 14/26 (53%), Positives = 16/26 (61%) Frame = +3 Query: 93 QYNTDAPIFPIPGRFPPAIDVYTDGP 170 QY +APIF IPGR P +YT P Sbjct: 727 QYFYEAPIFTIPGRTYPVEILYTKEP 752
>ATG3_EMENI (Q5AVG2) Autophagy-related protein 3 (Autophagy-related E2-like| conjugation enzyme atg3) Length = 787 Score = 29.3 bits (64), Expect = 3.0 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +3 Query: 27 KQKNLPPAPFKIIPPEWSLFIIQYNTDAP 113 K +++P +PF ++PPE L I Y D P Sbjct: 517 KLQSMPESPFLLLPPELRLQIYSYVLDIP 545
>Y4GI_RHISN (P55465) Hypothetical protein y4gI| Length = 909 Score = 28.1 bits (61), Expect = 6.8 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = -3 Query: 148 IAGGKRPGIGKMGASVLYCMINKDHSGGII-LNGAGGRFFCLLP 20 +A +RPG+G +GA + Y H+G +I L G G L P Sbjct: 730 VALAQRPGVGCVGAKLYYPDGRIQHAGVVIGLGGVAGHGHLLYP 773
>MOG5_CAEEL (Q09530) Probable pre-mRNA-splicing factor ATP-dependent RNA| helicase mog-5 (EC 3.6.1.-) (Sex determination protein mog-5) (Masculinization of germ line protein 5) Length = 1200 Score = 27.7 bits (60), Expect = 8.8 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +3 Query: 93 QYNTDAPIFPIPGRFPPAIDVYTDGP 170 +Y +APIF IPGR P +YT P Sbjct: 702 EYFLEAPIFTIPGRTFPVEILYTREP 727 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,581,054 Number of Sequences: 219361 Number of extensions: 498590 Number of successful extensions: 1072 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1064 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1072 length of database: 80,573,946 effective HSP length: 34 effective length of database: 73,115,672 effective search space used: 1754776128 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)