| Clone Name | rbaet44d01 |
|---|---|
| Clone Library Name | barley_pub |
>TNFL8_MOUSE (P32972) Tumor necrosis factor ligand superfamily member 8 (CD30| ligand) (CD30-L) (CD153 antigen) Length = 239 Score = 28.1 bits (61), Expect = 5.3 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = +1 Query: 286 QVYPGGTAQPQSLTSSWRARGTXRARLSTLALMAV 390 QV PG A P T WR+ LST AL+ + Sbjct: 21 QVQPGSVASPWRSTRPWRSTSRSYFYLSTTALVCL 55
>ARGC_BRUSU (P59314) N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38)| (AGPR) (N-acetyl-glutamate semialdehyde dehydrogenase) (NAGSA dehydrogenase) Length = 310 Score = 27.7 bits (60), Expect = 6.9 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +1 Query: 31 LIDTSTQHTITPSIATGYTNLTRFQTE 111 +IDTST H + P A G+ L + Q E Sbjct: 78 IIDTSTAHRVHPDWAYGFAELAKGQRE 104
>ARGC_BRUME (Q8YGI8) N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38)| (AGPR) (N-acetyl-glutamate semialdehyde dehydrogenase) (NAGSA dehydrogenase) Length = 310 Score = 27.7 bits (60), Expect = 6.9 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +1 Query: 31 LIDTSTQHTITPSIATGYTNLTRFQTE 111 +IDTST H + P A G+ L + Q E Sbjct: 78 IIDTSTTHRVHPDWAYGFAELAKGQRE 104
>CDS1_CAEEL (P53439) Putative phosphatidate cytidylyltransferase (EC 2.7.7.41)| (CDP-diglyceride synthetase) (CDP-diglyceride pyrophosphorylase) (CDP-diacylglycerol synthase) (CDP-DAG synthase) (CDP-DG synthetase) Length = 455 Score = 27.3 bits (59), Expect = 9.0 Identities = 15/46 (32%), Positives = 25/46 (54%) Frame = -1 Query: 173 FRFVHLVLLQHLFYFYYYCHHSV*NLVRFVYPVAMEGVIVCCVLVS 36 F + HL LL + ++ + L+ F+ PVAM I+CC ++S Sbjct: 213 FAWTHLTLLLIVSQSFFIIQNIFQGLIWFLAPVAM---IICCDIMS 255
>AMY1_SACFI (P21567) Alpha-amylase precursor (EC 3.2.1.1)| Length = 494 Score = 27.3 bits (59), Expect = 9.0 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +3 Query: 48 TTYNYTFHSHWIYKSYKISNGMMT 119 T Y Y +H +W+ YKI+ T Sbjct: 100 TAYGYAYHGYWMKNIYKINENFGT 123 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,643,635 Number of Sequences: 219361 Number of extensions: 781305 Number of successful extensions: 2119 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2009 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2116 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 1370455656 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)