ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbaet43e05 |
|---|---|
| Clone Library Name | barley_pub |
>PIP26_ORYSA (Q7XLR1) Probable aquaporin PIP2.6 (Plasma membrane intrinsic| protein 2.6) (OsPIP2.6) Length = 282 Score = 45.1 bits (105), Expect = 8e-05 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -3 Query: 437 GALAAAAYHQYILRAAAIKALG 372 GALAAAAYHQYILRAAAIKALG Sbjct: 253 GALAAAAYHQYILRAAAIKALG 274
>PIP1_ATRCA (P42767) Aquaporin PIP-type| Length = 282 Score = 44.7 bits (104), Expect = 1e-04 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = -3 Query: 437 GALAAAAYHQYILRAAAIKALG 372 GALAAAAYHQY+LRAAAIKALG Sbjct: 253 GALAAAAYHQYVLRAAAIKALG 274
>PIP27_ARATH (P93004) Aquaporin PIP2.7 (Plasma membrane intrinsic protein 3)| (Salt stress-induced major intrinsic protein) Length = 280 Score = 43.9 bits (102), Expect = 2e-04 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = -3 Query: 437 GALAAAAYHQYILRAAAIKALG 372 GALAAAAYHQYILRA+AIKALG Sbjct: 251 GALAAAAYHQYILRASAIKALG 272
>PIP28_ARATH (Q9ZVX8) Probable aquaporin PIP2.8 (Plasma membrane intrinsic| protein 3b) (PIP3b) Length = 278 Score = 42.7 bits (99), Expect = 4e-04 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -3 Query: 437 GALAAAAYHQYILRAAAIKAL 375 GALAAAAYHQYILRAAAIKAL Sbjct: 249 GALAAAAYHQYILRAAAIKAL 269
>PIP24_ARATH (Q9FF53) Probable aquaporin PIP2.4 (Plasma membrane intrinsic| protein 2.4) Length = 291 Score = 39.3 bits (90), Expect = 0.004 Identities = 19/22 (86%), Positives = 20/22 (90%) Frame = -3 Query: 437 GALAAAAYHQYILRAAAIKALG 372 GA AAA YHQ+ILRAAAIKALG Sbjct: 258 GAAAAAFYHQFILRAAAIKALG 279
>PIP21_ORYSA (Q8H5N9) Probable aquaporin PIP2.1 (Plasma membrane intrinsic| protein 2a) (PIP2a) (OsPIP2.1) Length = 290 Score = 37.4 bits (85), Expect = 0.016 Identities = 18/22 (81%), Positives = 18/22 (81%) Frame = -3 Query: 437 GALAAAAYHQYILRAAAIKALG 372 GA AA YHQYILRA AIKALG Sbjct: 263 GAAIAAFYHQYILRAGAIKALG 284
>PIP25_ARATH (Q9SV31) Probable aquaporin PIP2.5 (Plasma membrane intrinsic| protein 2d) (PIP2d) Length = 286 Score = 35.4 bits (80), Expect = 0.062 Identities = 16/22 (72%), Positives = 18/22 (81%) Frame = -3 Query: 437 GALAAAAYHQYILRAAAIKALG 372 GA AA YHQ++LRA AIKALG Sbjct: 257 GAAIAAFYHQFVLRAGAIKALG 278
>PIP26_ARATH (Q9ZV07) Probable aquaporin PIP2.6 (Plasma membrane intrinsic| protein 2e) (PIP2e) Length = 289 Score = 32.3 bits (72), Expect = 0.52 Identities = 14/22 (63%), Positives = 17/22 (77%) Frame = -3 Query: 437 GALAAAAYHQYILRAAAIKALG 372 GA AA YHQ++LRA A+KA G Sbjct: 257 GAAIAAFYHQFVLRAGAMKAYG 278
>PIP22_ORYSA (Q6K215) Probable aquaporin PIP2.2 (Plasma membrane intrinsic| protein 2.2) (OsPIP2.2) Length = 288 Score = 32.3 bits (72), Expect = 0.52 Identities = 14/19 (73%), Positives = 16/19 (84%) Frame = -3 Query: 437 GALAAAAYHQYILRAAAIK 381 GA AAAYHQY+LRA+A K Sbjct: 262 GAAIAAAYHQYVLRASAAK 280
>PIP23_ORYSA (Q7XUA6) Probable aquaporin PIP2.3 (Plasma membrane intrinsic| protein 2.3) (OsPIP2.3) Length = 290 Score = 32.3 bits (72), Expect = 0.52 Identities = 14/19 (73%), Positives = 16/19 (84%) Frame = -3 Query: 437 GALAAAAYHQYILRAAAIK 381 GA AAAYHQY+LRA+A K Sbjct: 263 GAAIAAAYHQYVLRASAAK 281
>SMYD4_PONPY (Q5R5X9) SET and MYND domain-containing protein 4| Length = 804 Score = 30.8 bits (68), Expect = 1.5 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +2 Query: 308 YCHRCIKLLAGVLSCSGCS 364 YCHRC+K + C GCS Sbjct: 295 YCHRCLKHTLATVPCDGCS 313
>SMYD4_HUMAN (Q8IYR2) SET and MYND domain-containing protein 4| Length = 804 Score = 30.8 bits (68), Expect = 1.5 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +2 Query: 308 YCHRCIKLLAGVLSCSGCS 364 YCHRC+K + C GCS Sbjct: 295 YCHRCLKHTLATVPCDGCS 313
>PIP23_ARATH (P30302) Aquaporin PIP2.3 (Plasma membrane intrinsic protein 2c)| (PIP2c) (TMP2C) (RD28-PIP) (Water stress-induced tonoplast intrinsic protein) (WSI-TIP) Length = 285 Score = 30.8 bits (68), Expect = 1.5 Identities = 13/22 (59%), Positives = 17/22 (77%) Frame = -3 Query: 437 GALAAAAYHQYILRAAAIKALG 372 GA AA YHQ++LRA+ K+LG Sbjct: 256 GATIAAFYHQFVLRASGSKSLG 277
>PIP22_ARATH (P43287) Aquaporin PIP2.2 (Plasma membrane intrinsic protein 2b)| (PIP2b) (TMP2b) Length = 285 Score = 30.8 bits (68), Expect = 1.5 Identities = 13/22 (59%), Positives = 17/22 (77%) Frame = -3 Query: 437 GALAAAAYHQYILRAAAIKALG 372 GA AA YHQ++LRA+ K+LG Sbjct: 256 GAAIAAFYHQFVLRASGSKSLG 277
>PIP21_ARATH (P43286) Aquaporin PIP2.1 (Plasma membrane intrinsic protein 2a)| (PIP2a) Length = 287 Score = 30.8 bits (68), Expect = 1.5 Identities = 13/22 (59%), Positives = 17/22 (77%) Frame = -3 Query: 437 GALAAAAYHQYILRAAAIKALG 372 GA AA YHQ++LRA+ K+LG Sbjct: 258 GAAIAAFYHQFVLRASGSKSLG 279
>SMYD4_CHICK (Q5F3V0) SET and MYND domain-containing protein 4| Length = 742 Score = 30.4 bits (67), Expect = 2.0 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +2 Query: 308 YCHRCIKLLAGVLSCSGCS 364 YCH C+K L + C GCS Sbjct: 294 YCHHCLKQLLASIPCCGCS 312
>PIP28_ORYSA (Q7Y1E6) Probable aquaporin PIP2.8 (Plasma membrane intrinsic| protein 2.8) (OsPIP2.8) Length = 280 Score = 30.0 bits (66), Expect = 2.6 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -3 Query: 437 GALAAAAYHQYILRAAAIKA 378 GA AA YH YILR AA KA Sbjct: 250 GAAAAMIYHHYILRGAAAKA 269
>UBR1_CAEEL (P91133) Ubiquitin-protein ligase E3 component N-recognin (EC| 6.-.-.-) (Ubiquitin-protein ligase E3-alpha) Length = 1927 Score = 29.6 bits (65), Expect = 3.4 Identities = 16/49 (32%), Positives = 22/49 (44%) Frame = -2 Query: 366 PEQPEQLSTPANNLMQRWQYCSSCPSGAS*PHKRTGFVLAVLLLHRAHP 220 P +P+ TP + L+ S P+ A PH T F V L + A P Sbjct: 1560 PPRPKLAQTPGSPLLSAPSTSSFTPAPAQIPHSGTNFAFLVQLFNPAGP 1608
>CATA_BACST (P14412) Peroxidase/catalase (EC 1.11.1.6) (Catalase-peroxidase)| Length = 735 Score = 28.9 bits (63), Expect = 5.8 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +3 Query: 168 WWPLSLSLTCMHRH*TRPDGHD 233 WWP L+L+ +H+H + + HD Sbjct: 31 WWPNQLNLSILHQHDRKTNPHD 52
>PIP27_ORYSA (Q651D5) Probable aquaporin PIP2.7 (Plasma membrane intrinsic| protein 2.7) (OsPIP2.7) Length = 290 Score = 28.9 bits (63), Expect = 5.8 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = -3 Query: 437 GALAAAAYHQYILRAAAIKAL 375 GA AAAYH+ +LR A KAL Sbjct: 260 GAFLAAAYHKLVLRGEAAKAL 280
>TELT_MOUSE (O70548) Telethonin (Titin cap protein)| Length = 167 Score = 28.5 bits (62), Expect = 7.6 Identities = 13/39 (33%), Positives = 17/39 (43%) Frame = +2 Query: 203 QTLNEAGWARWRSSTANTKPVRLCG*LAPDGHEEQYCHR 319 Q EA WA W+ T +T+P C D + HR Sbjct: 15 QERREAFWAEWKDLTLSTRPEEGCSLHEEDTQRHETYHR 53
>SMYD4_MOUSE (Q8BTK5) SET and MYND domain-containing protein 4| Length = 799 Score = 28.5 bits (62), Expect = 7.6 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = +2 Query: 308 YCHRCIKLLAGVLSCSGCS 364 YCHRC+K + C CS Sbjct: 295 YCHRCLKHTLATVPCGSCS 313 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 55,089,116 Number of Sequences: 219361 Number of extensions: 1022382 Number of successful extensions: 2583 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 2508 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2582 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2570413340 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
