| Clone Name | rbaet43d04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ZN445_HUMAN (P59923) Zinc finger protein 445 | 30 | 1.1 | 2 | CXX1_HUMAN (O15255) CAAX box protein 1 (Cerebral protein 5) | 28 | 5.3 | 3 | AOAH_RABIT (O18823) Acyloxyacyl hydrolase precursor (EC 3.1.1.77... | 28 | 6.9 | 4 | Y900_TREPA (O83870) Hypothetical protein TP0900 | 27 | 9.0 |
|---|
>ZN445_HUMAN (P59923) Zinc finger protein 445| Length = 1031 Score = 30.4 bits (67), Expect = 1.1 Identities = 21/75 (28%), Positives = 31/75 (41%), Gaps = 6/75 (8%) Frame = +2 Query: 62 NYSHPTGKEIQKKYSRSI*SPHRTCDVLHCGGEKRIM*SSCGVMQQQQRRRNDHQTYA-- 235 N+SH TGK+ + S S+ H T L G K + CG + D++ Y Sbjct: 379 NFSHRTGKDSEVSGSNSLDLKHVT--YLRVSGRKESLKHGCGKHFRMSSHHYDYKKYGKG 436 Query: 236 ----LGGYLATQSTH 268 +GG+ Q H Sbjct: 437 LRHMIGGFSLHQRIH 451
>CXX1_HUMAN (O15255) CAAX box protein 1 (Cerebral protein 5)| Length = 209 Score = 28.1 bits (61), Expect = 5.3 Identities = 13/43 (30%), Positives = 17/43 (39%) Frame = +3 Query: 168 SCNLRVELCSSSSGGVMIIRRTPWAGTWRRSPPTGCRPPSSPV 296 SC+L C S PWA W PP+ P+ P+ Sbjct: 54 SCSLPRSACLCSRNSAPGSCCRPWASLWSEPPPSPSSQPAPPM 96
>AOAH_RABIT (O18823) Acyloxyacyl hydrolase precursor (EC 3.1.1.77) [Contains:| Acyloxyacyl hydrolase small subunit; Acyloxyacyl hydrolase large subunit] Length = 575 Score = 27.7 bits (60), Expect = 6.9 Identities = 12/23 (52%), Positives = 19/23 (82%), Gaps = 1/23 (4%) Frame = -2 Query: 229 RLMIITPPLLL-LHNSTRRLHDS 164 R+++++P LLL LH+ST R HD+ Sbjct: 6 RILVVSPLLLLPLHSSTSRAHDN 28
>Y900_TREPA (O83870) Hypothetical protein TP0900| Length = 797 Score = 27.3 bits (59), Expect = 9.0 Identities = 17/52 (32%), Positives = 23/52 (44%), Gaps = 3/52 (5%) Frame = +3 Query: 150 AVGRKESCNLRVELCSSSSGGVMI---IRRTPWAGTWRRSPPTGCRPPSSPV 296 A GR CNL + + G V + R P G+W+R + C PP V Sbjct: 91 AEGRALFCNL-IPPAYAQDGAVFVQWLARILPQLGSWQRRVESHCMPPKDAV 141 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,316,818 Number of Sequences: 219361 Number of extensions: 946356 Number of successful extensions: 2149 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2096 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2148 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 1365190992 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)