| Clone Name | rbaet42b02 |
|---|---|
| Clone Library Name | barley_pub |
>GAST_HUMAN (P01350) Gastrin precursor [Contains: Gastrin 71 (Component I);| Gastrin 52 (G52); Big gastrin (Gastrin 34) (G34) (Component II); Gastrin (Gastrin 17) (G17) (Component III); Gastrin 14 (G14); Gastrin 6 (G6)] Length = 101 Score = 30.4 bits (67), Expect = 1.8 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -2 Query: 267 LPWLRQAGPARHARQVLNP 211 LPWL Q GPA H R+ L P Sbjct: 44 LPWLEQQGPASHHRRQLGP 62
>APT_HUMAN (P07741) Adenine phosphoribosyltransferase (EC 2.4.2.7) (APRT)| Length = 179 Score = 30.0 bits (66), Expect = 2.3 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +1 Query: 199 SHGGRVQYLTGMPSRSSLPEPG*ALLVNLAC 291 +HGGR+ Y+ G+ SR L P A + L C Sbjct: 52 THGGRIDYIAGLDSRGFLFGPSLAQELGLGC 82
>APT_CRIGR (P47952) Adenine phosphoribosyltransferase (EC 2.4.2.7) (APRT)| Length = 180 Score = 28.9 bits (63), Expect = 5.1 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +1 Query: 199 SHGGRVQYLTGMPSRSSLPEPG*ALLVNLAC 291 +HGG++ Y+ G+ SR L P A + L C Sbjct: 53 THGGKIDYIAGLDSRGFLFGPSLAQELGLGC 83
>RPC1_YEAST (P04051) DNA-directed RNA polymerase III largest subunit (EC 2.7.7.6)| (C160) Length = 1460 Score = 28.9 bits (63), Expect = 5.1 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = +3 Query: 57 VNKSKVASTPVVNADLIREHSAR 125 +N SKV STP++NA L+ ++ R Sbjct: 1130 INASKVISTPIINAVLVNDNDER 1152
>APT_GERCA (Q64414) Adenine phosphoribosyltransferase (EC 2.4.2.7) (APRT)| Length = 180 Score = 28.5 bits (62), Expect = 6.7 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 202 HGGRVQYLTGMPSRSSLPEPG*ALLVNLAC 291 HGG++ Y+ G+ SR L P A + L C Sbjct: 54 HGGKIDYIAGLDSRGFLFGPSLAQELGLGC 83
>NOTC3_HUMAN (Q9UM47) Neurogenic locus notch homolog protein 3 precursor (Notch 3)| [Contains: Notch 3 extracellular truncation; Notch 3 intracellular domain] Length = 2321 Score = 28.5 bits (62), Expect = 6.7 Identities = 18/43 (41%), Positives = 20/43 (46%) Frame = -1 Query: 262 LAPAGWTGSACPSSTEPCRHVTTWSPAAQ*S*WRQFVRLELLC 134 L P GW+G C + PCR AAQ VRLE LC Sbjct: 1023 LCPPGWSGRLCDIRSLPCREA-----AAQIG-----VRLEQLC 1055 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,797,877 Number of Sequences: 219361 Number of extensions: 647060 Number of successful extensions: 1600 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1486 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1600 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2278320915 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)