| Clone Name | rbaet41f06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CBL_MLVCN (P23092) Transforming protein cbl | 29 | 6.6 | 2 | CBL_MOUSE (P22682) E3 ubiquitin-protein ligase CBL (EC 6.3.2.-) ... | 29 | 6.6 | 3 | NADE_HALSA (Q9HNM7) NH(3)-dependent NAD(+) synthetase (EC 6.3.1.5) | 29 | 6.6 | 4 | DUT_HHV6Z (P52541) Deoxyuridine 5'-triphosphate nucleotidohydrol... | 28 | 8.6 | 5 | CLPH_ONCVO (P37801) Calponin homolog OV9M | 28 | 8.6 |
|---|
>CBL_MLVCN (P23092) Transforming protein cbl| Length = 390 Score = 28.9 bits (63), Expect = 6.6 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 274 IKSTFQPSHRHHHQPASLPC 333 +K FQP H HHH PC Sbjct: 60 MKDAFQPHHHHHHLSPHPPC 79
>CBL_MOUSE (P22682) E3 ubiquitin-protein ligase CBL (EC 6.3.2.-) (Signal| transduction protein CBL) (Proto-oncogene c-CBL) (Casitas B-lineage lymphoma proto-oncogene) Length = 913 Score = 28.9 bits (63), Expect = 6.6 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 274 IKSTFQPSHRHHHQPASLPC 333 +K FQP H HHH PC Sbjct: 28 MKDAFQPHHHHHHLSPHPPC 47
>NADE_HALSA (Q9HNM7) NH(3)-dependent NAD(+) synthetase (EC 6.3.1.5)| Length = 268 Score = 28.9 bits (63), Expect = 6.6 Identities = 15/42 (35%), Positives = 24/42 (57%) Frame = +2 Query: 110 GSSTKYGVGDRIVDRHPYEGLH*LTKREIGRSSASPDDALTR 235 G TKYG D+ VD +P L+ + R++ R P+D +T+ Sbjct: 158 GYYTKYG--DQAVDCNPIGNLYKMQVRQLARDLGVPEDLVTK 197
>DUT_HHV6Z (P52541) Deoxyuridine 5'-triphosphate nucleotidohydrolase (EC| 3.6.1.23) (dUTPase) (dUTP pyrophosphatase) Length = 376 Score = 28.5 bits (62), Expect = 8.6 Identities = 21/72 (29%), Positives = 30/72 (41%), Gaps = 2/72 (2%) Frame = +1 Query: 163 RRITLINKT*NRSVFS*SR*CTNEDDKETTTAPVIT--GIKSTFQPSHRHHHQPASLPCF 336 R I+L+ N +V S+ C E +ET + G TF P HR + C Sbjct: 72 RPISLLGIPQNGTV---SKTCKREKQRETDCVNYVRKHGNPVTFYPRHRAKRNANTDTCI 128 Query: 337 TTHPSTYAQHNR 372 + PS H+R Sbjct: 129 SEEPSILVSHHR 140
>CLPH_ONCVO (P37801) Calponin homolog OV9M| Length = 378 Score = 28.5 bits (62), Expect = 8.6 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = -3 Query: 334 SMEGKLAGGGDDERVGRWT 278 +ME ++AG G +RVGRWT Sbjct: 21 TMETRVAGQGQPKRVGRWT 39 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 65,048,748 Number of Sequences: 219361 Number of extensions: 1240922 Number of successful extensions: 3008 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2916 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3003 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2909956200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)