| Clone Name | rbaet41b02 |
|---|---|
| Clone Library Name | barley_pub |
>CB4B_LYCES (P27525) Chlorophyll a-b binding protein CP24 10B, chloroplast| precursor (CAB-10B) (LHCP) Length = 256 Score = 34.7 bits (78), Expect = 0.063 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 303 YLEAGQGKTPLGALGL 256 Y EAGQGKTPLGALGL Sbjct: 241 YFEAGQGKTPLGALGL 256
>CB4A_LYCES (P27524) Chlorophyll a-b binding protein CP24 10A, chloroplast| precursor (CAB-10A) (LHCP) Length = 256 Score = 34.7 bits (78), Expect = 0.063 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 303 YLEAGQGKTPLGALGL 256 Y EAGQGKTPLGALGL Sbjct: 241 YFEAGQGKTPLGALGL 256
>CB4_SPIOL (P36494) Chlorophyll a-b binding protein CP24, chloroplast| precursor Length = 261 Score = 34.7 bits (78), Expect = 0.063 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 303 YLEAGQGKTPLGALGL 256 Y EAGQGKTPLGALGL Sbjct: 246 YFEAGQGKTPLGALGL 261
>RPA2_NEUCR (O74633) DNA-directed RNA polymerase I polypeptide 2 (EC 2.7.7.6)| (RNA polymerase I subunit 2) Length = 1234 Score = 28.9 bits (63), Expect = 3.5 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +3 Query: 54 ITWYIRWRKKEYLIPHSIYTRHLKEVTDTD 143 +T+ WRK EYLIP + + L E D + Sbjct: 252 VTFRFSWRKNEYLIPVMMIMKALVETNDRE 281
>EMAL2_HUMAN (O95834) Echinoderm microtubule-associated protein-like 2 (EMAP-2)| (HuEMAP-2) Length = 649 Score = 28.5 bits (62), Expect = 4.5 Identities = 10/41 (24%), Positives = 19/41 (46%) Frame = -2 Query: 248 IFGWRAVGERVCCIASDRTHGLNGICSTSNKQQHFICVRDF 126 + G VCC+ +++G N +C+ H + V D+ Sbjct: 152 VLGLGVFDRAVCCVGFSKSNGGNLLCAVDESNDHMLSVWDW 192
>RPA2_SCHPO (Q9P7X8) Probable DNA-directed RNA polymerase I polypeptide 2 (EC| 2.7.7.6) (RNA polymerase I subunit 2) Length = 1227 Score = 28.5 bits (62), Expect = 4.5 Identities = 16/52 (30%), Positives = 25/52 (48%), Gaps = 5/52 (9%) Frame = +3 Query: 3 IKCLLPILP*ITELGLYIT-----WYIRWRKKEYLIPHSIYTRHLKEVTDTD 143 I+C+ P +T Y+ + WRK EYLIP + + L E +D + Sbjct: 268 IRCVRPDQSSLTNTLHYLNNGVTMFRFHWRKNEYLIPSMMILKALLETSDKE 319
>RPA2_ASHGO (Q75DS1) DNA-directed RNA polymerase I polypeptide 2 (EC 2.7.7.6)| (RNA polymerase I subunit 2) Length = 1198 Score = 28.1 bits (61), Expect = 5.9 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = +3 Query: 54 ITWYIRWRKKEYLIPHSIYTRHLKEVTDTD 143 +T+ WRK EYL+P + + L + +D + Sbjct: 252 VTFRFSWRKNEYLVPVVLILKALTDASDRE 281 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,814,226 Number of Sequences: 219361 Number of extensions: 803707 Number of successful extensions: 2079 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2049 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2079 length of database: 80,573,946 effective HSP length: 76 effective length of database: 63,902,510 effective search space used: 1533660240 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)