| Clone Name | rbaet40g05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | AAKG3_PIG (Q9MYP4) 5'-AMP-activated protein kinase, gamma-3 subu... | 31 | 0.82 | 2 | UL16_VZVD (P09293) Gene 44 protein | 31 | 1.1 | 3 | AAKG3_HUMAN (Q9UGI9) 5'-AMP-activated protein kinase, gamma-3 su... | 30 | 2.4 | 4 | CYTC_RAT (P14841) Cystatin C precursor | 28 | 9.1 | 5 | VG42_HAEIN (P44236) Mu-like prophage FluMu protein gp42 | 28 | 9.1 |
|---|
>AAKG3_PIG (Q9MYP4) 5'-AMP-activated protein kinase, gamma-3 subunit (AMPK| gamma-3 chain) (AMPK gamma3) Length = 514 Score = 31.2 bits (69), Expect = 0.82 Identities = 16/38 (42%), Positives = 24/38 (63%), Gaps = 2/38 (5%) Frame = +2 Query: 38 LSGSVIVTKSNKRIYHRLHF--TLSPTPVFIYHTVQTL 145 +SG+V+ ++KR+ LH TL P P F+Y T+Q L Sbjct: 339 VSGAVLHILTHKRLLKFLHIFGTLLPRPSFLYRTIQDL 376
>UL16_VZVD (P09293) Gene 44 protein| Length = 363 Score = 30.8 bits (68), Expect = 1.1 Identities = 12/29 (41%), Positives = 21/29 (72%) Frame = +1 Query: 61 KKQQKNLPPATFHLIPHTSFYLSYSTDAS 147 + +Q NLPP TFH+I + ++ +SY+ A+ Sbjct: 84 RPRQMNLPPKTFHVIVNFNYEVSYAMTAT 112
>AAKG3_HUMAN (Q9UGI9) 5'-AMP-activated protein kinase, gamma-3 subunit (AMPK| gamma-3 chain) (AMPK gamma3) Length = 489 Score = 29.6 bits (65), Expect = 2.4 Identities = 15/38 (39%), Positives = 24/38 (63%), Gaps = 2/38 (5%) Frame = +2 Query: 38 LSGSVIVTKSNKRIYHRLHF--TLSPTPVFIYHTVQTL 145 +SG+V+ ++KR+ LH +L P P F+Y T+Q L Sbjct: 314 VSGNVLHILTHKRLLKFLHIFGSLLPRPSFLYRTIQDL 351
>CYTC_RAT (P14841) Cystatin C precursor| Length = 140 Score = 27.7 bits (60), Expect = 9.1 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +1 Query: 16 GIYYYTRIERERDRDKKQQKNLPPATFHLIPH 111 GI YY +E R K Q NL FH PH Sbjct: 79 GINYYLDVEMGRTTCTKSQTNLTNCPFHDQPH 110
>VG42_HAEIN (P44236) Mu-like prophage FluMu protein gp42| Length = 631 Score = 27.7 bits (60), Expect = 9.1 Identities = 15/25 (60%), Positives = 17/25 (68%), Gaps = 1/25 (4%) Frame = +1 Query: 16 GIYYYTRIERERDRDKK-QQKNLPP 87 G Y Y IE RD+DKK Q+KN PP Sbjct: 418 GGYGYDVIEDGRDKDKKTQKKNKPP 442 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 21,262,388 Number of Sequences: 219361 Number of extensions: 276449 Number of successful extensions: 909 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 855 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 907 length of database: 80,573,946 effective HSP length: 24 effective length of database: 75,309,282 effective search space used: 1807422768 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)