| Clone Name | rbaet40e09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YL52_CAEEL (P34431) Hypothetical protein F44E2.2 in chromosome III | 29 | 4.0 | 2 | ISPG_CHLMU (Q9PKY3) 4-hydroxy-3-methylbut-2-en-1-yl diphosphate ... | 28 | 9.0 | 3 | NU5M_DINSE (O79556) NADH-ubiquinone oxidoreductase chain 5 (EC 1... | 28 | 9.0 | 4 | FBLN4_MOUSE (Q9WVJ9) EGF-containing fibulin-like extracellular m... | 28 | 9.0 |
|---|
>YL52_CAEEL (P34431) Hypothetical protein F44E2.2 in chromosome III| Length = 2186 Score = 28.9 bits (63), Expect = 4.0 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = -3 Query: 142 CGEIKKCGYCVISSSFTCMYLCFCV*FLVPCVYNNVCLDES 20 C EI +S F+C Y+C C L PC++N + E+ Sbjct: 1841 CDEITVVSENNENSCFSCRYICRCA--LKPCMFNMTLVPEA 1879
>ISPG_CHLMU (Q9PKY3) 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (EC| 1.17.4.3) (1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase) Length = 601 Score = 27.7 bits (60), Expect = 9.0 Identities = 15/42 (35%), Positives = 19/42 (45%) Frame = +3 Query: 3 ELYACLDSSKHTLLYTQGTKNYTQKHKYMHVKLLEITQ*PHF 128 E+ CLD K T Y++ TK Y Y +L T HF Sbjct: 279 EIPVCLDLLKETAKYSKSTKKYNPFEIYHSKQLTTQTTPKHF 320
>NU5M_DINSE (O79556) NADH-ubiquinone oxidoreductase chain 5 (EC 1.6.5.3) (NADH| dehydrogenase subunit 5) Length = 590 Score = 27.7 bits (60), Expect = 9.0 Identities = 12/17 (70%), Positives = 13/17 (76%), Gaps = 1/17 (5%) Frame = +1 Query: 25 HPNTHYYTHKEPK-ITH 72 HP TH+ THKE K ITH Sbjct: 423 HPRTHHTTHKETKNITH 439
>FBLN4_MOUSE (Q9WVJ9) EGF-containing fibulin-like extracellular matrix protein 2| precursor (Fibulin-4) (FIBL-4) (Mutant p53-binding protein 1) Length = 443 Score = 27.7 bits (60), Expect = 9.0 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = -3 Query: 154 DPESCGEIKKCGYCVISSSFTCMYLC 77 D SC +I +CGY SS+ C Y C Sbjct: 237 DGFSCSDIDECGY----SSYLCQYRC 258 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 25,502,024 Number of Sequences: 219361 Number of extensions: 390282 Number of successful extensions: 1186 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1142 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1186 length of database: 80,573,946 effective HSP length: 29 effective length of database: 74,212,477 effective search space used: 1781099448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)