ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbaet40d08 |
|---|---|
| Clone Library Name | barley_pub |
>PORA_WHEAT (Q41578) Protochlorophyllide reductase A, chloroplast precursor (EC| 1.3.1.33) (PCR A) (NADPH-protochlorophyllide oxidoreductase A) (POR A) Length = 388 Score = 50.4 bits (119), Expect = 1e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -2 Query: 305 SQEASDPEKARKVWELSEKLVGLA 234 SQEASDPEKARKVWELSEKLVGLA Sbjct: 365 SQEASDPEKARKVWELSEKLVGLA 388
>PORA_HORVU (P13653) Protochlorophyllide reductase A, chloroplast precursor (EC| 1.3.1.33) (PCR A) (NADPH-protochlorophyllide oxidoreductase A) (POR A) Length = 388 Score = 50.4 bits (119), Expect = 1e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -2 Query: 305 SQEASDPEKARKVWELSEKLVGLA 234 SQEASDPEKARKVWELSEKLVGLA Sbjct: 365 SQEASDPEKARKVWELSEKLVGLA 388
>POR_AVESA (P15904) Protochlorophyllide reductase (EC 1.3.1.33) (PCR)| (NADPH-protochlorophyllide oxidoreductase) (POR) (Fragment) Length = 313 Score = 50.4 bits (119), Expect = 1e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -2 Query: 305 SQEASDPEKARKVWELSEKLVGLA 234 SQEASDPEKARKVWELSEKLVGLA Sbjct: 290 SQEASDPEKARKVWELSEKLVGLA 313
>PORA_CUCSA (Q41249) Protochlorophyllide reductase, chloroplast precursor (EC| 1.3.1.33) (PCR) (NADPH-protochlorophyllide oxidoreductase) (POR) Length = 398 Score = 47.4 bits (111), Expect = 9e-06 Identities = 23/24 (95%), Positives = 23/24 (95%) Frame = -2 Query: 305 SQEASDPEKARKVWELSEKLVGLA 234 SQEASD EKARKVWELSEKLVGLA Sbjct: 375 SQEASDAEKARKVWELSEKLVGLA 398
>PORB_HORVU (Q42850) Protochlorophyllide reductase B, chloroplast precursor (EC| 1.3.1.33) (PCR B) (NADPH-protochlorophyllide oxidoreductase B) (POR B) Length = 395 Score = 46.2 bits (108), Expect = 2e-05 Identities = 22/24 (91%), Positives = 23/24 (95%) Frame = -2 Query: 305 SQEASDPEKARKVWELSEKLVGLA 234 S+EASD EKARKVWELSEKLVGLA Sbjct: 372 SEEASDTEKARKVWELSEKLVGLA 395
>POR_PEA (Q01289) Protochlorophyllide reductase, chloroplast precursor (EC| 1.3.1.33) (PCR) (NADPH-protochlorophyllide oxidoreductase) (POR) Length = 399 Score = 46.2 bits (108), Expect = 2e-05 Identities = 22/24 (91%), Positives = 23/24 (95%) Frame = -2 Query: 305 SQEASDPEKARKVWELSEKLVGLA 234 SQEASD EKARKVWE+SEKLVGLA Sbjct: 376 SQEASDAEKARKVWEVSEKLVGLA 399
>PORB_ARATH (P21218) Protochlorophyllide reductase B, chloroplast precursor (EC| 1.3.1.33) (PCR B) (NADPH-protochlorophyllide oxidoreductase B) (POR B) Length = 401 Score = 45.1 bits (105), Expect = 5e-05 Identities = 21/24 (87%), Positives = 23/24 (95%) Frame = -2 Query: 305 SQEASDPEKARKVWELSEKLVGLA 234 S+EASD EKARKVWE+SEKLVGLA Sbjct: 378 SEEASDVEKARKVWEISEKLVGLA 401
>PORA_ARATH (Q42536) Protochlorophyllide reductase A, chloroplast precursor (EC| 1.3.1.33) (PCR A) (NADPH-protochlorophyllide oxidoreductase A) (POR A) Length = 405 Score = 44.7 bits (104), Expect = 6e-05 Identities = 21/24 (87%), Positives = 23/24 (95%) Frame = -2 Query: 305 SQEASDPEKARKVWELSEKLVGLA 234 SQEASD EKAR+VWE+SEKLVGLA Sbjct: 382 SQEASDVEKARRVWEVSEKLVGLA 405
>POR_DAUCA (Q9SDT1) Protochlorophyllide reductase, chloroplast precursor (EC| 1.3.1.33) (PCR) (NADPH-protochlorophyllide oxidoreductase) (POR) Length = 398 Score = 44.7 bits (104), Expect = 6e-05 Identities = 21/24 (87%), Positives = 23/24 (95%) Frame = -2 Query: 305 SQEASDPEKARKVWELSEKLVGLA 234 S+EASD EKARKVWE+SEKLVGLA Sbjct: 375 SEEASDVEKARKVWEVSEKLVGLA 398
>PORC_ARATH (O48741) Protochlorophyllide reductase C, chloroplast precursor (EC| 1.3.1.33) (PCR C) (NADPH-protochlorophyllide oxidoreductase C) (POR C) Length = 401 Score = 42.4 bits (98), Expect = 3e-04 Identities = 19/24 (79%), Positives = 23/24 (95%) Frame = -2 Query: 305 SQEASDPEKARKVWELSEKLVGLA 234 S+EASD EKA+K+WE+SEKLVGLA Sbjct: 378 SKEASDAEKAKKLWEVSEKLVGLA 401
>POR_MARPA (O80333) Protochlorophyllide reductase, chloroplast precursor (EC| 1.3.1.33) (PCR) (NADPH-protochlorophyllide oxidoreductase) (POR) Length = 458 Score = 38.9 bits (89), Expect = 0.003 Identities = 16/23 (69%), Positives = 22/23 (95%) Frame = -2 Query: 305 SQEASDPEKARKVWELSEKLVGL 237 S+EAS+PEKA+++WELSE+L GL Sbjct: 435 SEEASNPEKAKRLWELSERLSGL 457
>POR_PLEBO (O66148) Light-dependent protochlorophyllide reductase (EC| 1.3.1.33) (PCR) (NADPH-protochlorophyllide oxidoreductase) (POR) (LPOR) Length = 322 Score = 36.2 bits (82), Expect = 0.022 Identities = 15/24 (62%), Positives = 21/24 (87%) Frame = -2 Query: 305 SQEASDPEKARKVWELSEKLVGLA 234 S++ +D KA+++WELSEKLVGLA Sbjct: 299 SEKVTDDAKAKRMWELSEKLVGLA 322
>POR_SYNY3 (Q59987) Light-dependent protochlorophyllide reductase (EC| 1.3.1.33) (PCR) (NADPH-protochlorophyllide oxidoreductase) (POR) (LPOR) Length = 322 Score = 35.8 bits (81), Expect = 0.028 Identities = 14/23 (60%), Positives = 21/23 (91%) Frame = -2 Query: 305 SQEASDPEKARKVWELSEKLVGL 237 S++ SD +KA+++W+LSEKLVGL Sbjct: 299 SEQGSDAQKAQRMWDLSEKLVGL 321
>POR_CHLRE (Q39617) Protochlorophyllide reductase, chloroplast precursor (EC| 1.3.1.33) (PCR) (NADPH-protochlorophyllide oxidoreductase) (POR) Length = 397 Score = 32.7 bits (73), Expect = 0.24 Identities = 13/24 (54%), Positives = 19/24 (79%) Frame = -2 Query: 305 SQEASDPEKARKVWELSEKLVGLA 234 S+E +D KA K+W++S KLVGL+ Sbjct: 373 SEEVADDSKASKLWDISAKLVGLS 396
>RDH13_MOUSE (Q8CEE7) Retinol dehydrogenase 13 (EC 1.1.1.-)| Length = 334 Score = 31.2 bits (69), Expect = 0.69 Identities = 15/30 (50%), Positives = 20/30 (66%) Frame = -2 Query: 305 SQEASDPEKARKVWELSEKLVGLA*STANP 216 S EA D E AR++W S +LVGLA + +P Sbjct: 297 SPEAEDEEVARRLWTESARLVGLAMAHGSP 326
>GANA_HUMIN (P83691) Arabinogalactan endo-1,4-beta-galactosidase (EC 3.2.1.89)| (Endo-1,4-beta-galactanase) (Galactanase) Length = 332 Score = 30.4 bits (67), Expect = 1.2 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = -3 Query: 109 QERPCEWPRECIDLVWKMYNFRQTLE**NRRPD*G 5 Q P WP + +L WK+YN+ TL+ NR D G Sbjct: 92 QTTPAGWPSDINNLAWKLYNY--TLDSMNRFADAG 124
>WWOX_MOUSE (Q91WL8) WW domain-containing oxidoreductase (EC 1.1.1.-)| Length = 414 Score = 29.6 bits (65), Expect = 2.0 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = -2 Query: 305 SQEASDPEKARKVWELSEKLV 243 S+EA E AR +WELSE+L+ Sbjct: 385 SEEAQSEETARALWELSERLI 405
>ATXR3_ARATH (O23372) Probable histone-lysine N-methyltransferase ATXR3 (EC| 2.1.1.43) (Trithorax-related protein 3) (TRX-related protein 3) (Protein SET DOMAIN GROUP 2) Length = 2351 Score = 29.3 bits (64), Expect = 2.6 Identities = 21/56 (37%), Positives = 31/56 (55%) Frame = +3 Query: 27 YYSNVCRKLYIFHTRSMHSRGHSQGLSCVIELLKRRKHDNYQISLKKRQVEHRPAS 194 Y S+ CRKL +RS+HS +SQ + E L R + + SL+K +H+ AS Sbjct: 322 YGSSKCRKLSDDCSRSLHSDHYSQHSA---ERLYRDSYPSKNSSLEKYPRKHQDAS 374
>WWOX_BRARE (Q803A8) WW domain-containing oxidoreductase (EC 1.1.1.-)| Length = 412 Score = 28.5 bits (62), Expect = 4.5 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = -2 Query: 305 SQEASDPEKARKVWELSEKLV 243 S +A DP A +WELSE+LV Sbjct: 382 SPQAQDPAAALSLWELSERLV 402
>RPOB_STRPM (Q48VR1) DNA-directed RNA polymerase beta chain (EC 2.7.7.6) (RNAP| beta subunit) (Transcriptase beta chain) (RNA polymerase beta subunit) Length = 1188 Score = 28.1 bits (61), Expect = 5.9 Identities = 17/59 (28%), Positives = 27/59 (45%), Gaps = 2/59 (3%) Frame = -1 Query: 255 REARRTRMIHRKSHGCMHASRTPADAQLVVFLNL--FGNYHVYAFLEAQLRRRGLASGR 85 R R +H +G M TP + + NL FG+ + Y F++ R+ A+GR Sbjct: 502 RAGYEVRDVHYTHYGRMCPIETPEGPNIGLINNLSSFGHLNKYGFIQTPYRKVDRATGR 560
>RPOB_STRP6 (Q5XE97) DNA-directed RNA polymerase beta chain (EC 2.7.7.6) (RNAP| beta subunit) (Transcriptase beta chain) (RNA polymerase beta subunit) Length = 1188 Score = 28.1 bits (61), Expect = 5.9 Identities = 17/59 (28%), Positives = 27/59 (45%), Gaps = 2/59 (3%) Frame = -1 Query: 255 REARRTRMIHRKSHGCMHASRTPADAQLVVFLNL--FGNYHVYAFLEAQLRRRGLASGR 85 R R +H +G M TP + + NL FG+ + Y F++ R+ A+GR Sbjct: 502 RAGYEVRDVHYTHYGRMCPIETPEGPNIGLINNLSSFGHLNKYGFIQTPYRKVDRATGR 560
>RPOB_STRP3 (Q8K8W3) DNA-directed RNA polymerase beta chain (EC 2.7.7.6) (RNAP| beta subunit) (Transcriptase beta chain) (RNA polymerase beta subunit) Length = 1188 Score = 28.1 bits (61), Expect = 5.9 Identities = 17/59 (28%), Positives = 27/59 (45%), Gaps = 2/59 (3%) Frame = -1 Query: 255 REARRTRMIHRKSHGCMHASRTPADAQLVVFLNL--FGNYHVYAFLEAQLRRRGLASGR 85 R R +H +G M TP + + NL FG+ + Y F++ R+ A+GR Sbjct: 502 RAGYEVRDVHYTHYGRMCPIETPEGPNIGLINNLSSFGHLNKYGFIQTPYRKVDRATGR 560
>DHAK_ECOLI (P76015) PTS-dependent dihydroxyacetone kinase,| dihydroxyacetone-binding subunit dhaK (EC 2.7.-.-) Length = 366 Score = 28.1 bits (61), Expect = 5.9 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = -2 Query: 260 LSEKLVGLA*STANPMDACMHLGRR 186 L EKLVG A + +DAC LGR+ Sbjct: 165 LIEKLVGAAAERGDSLDACAELGRK 189
>GANA_THIHE (P83692) Arabinogalactan endo-1,4-beta-galactosidase (EC 3.2.1.89)| (Endo-1,4-beta-galactanase) (Galactanase) Length = 332 Score = 27.7 bits (60), Expect = 7.7 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -3 Query: 109 QERPCEWPRECIDLVWKMYNF 47 Q P WP + +L WK+YN+ Sbjct: 92 QTMPAGWPSDIDNLSWKLYNY 112
>RDH14_HUMAN (Q9HBH5) Retinol dehydrogenase 14 (EC 1.1.1.-) (Alcohol| dehydrogenase PAN2) Length = 336 Score = 27.7 bits (60), Expect = 7.7 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = -2 Query: 299 EASDPEKARKVWELSEKLVGL 237 +A D ARK+W++SE +VGL Sbjct: 314 KAMDESVARKLWDISEVMVGL 334 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,561,953 Number of Sequences: 219361 Number of extensions: 644030 Number of successful extensions: 1724 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 1704 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1724 length of database: 80,573,946 effective HSP length: 77 effective length of database: 63,683,149 effective search space used: 1528395576 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
