| Clone Name | rbaet39h11 |
|---|---|
| Clone Library Name | barley_pub |
>LAS17_YEAST (Q12446) Proline-rich protein LAS17| Length = 633 Score = 30.8 bits (68), Expect = 0.93 Identities = 15/47 (31%), Positives = 22/47 (46%), Gaps = 3/47 (6%) Frame = +3 Query: 147 RRCRQAHTPRRDGRFENY---YSVRGRDTIHVRAHQQPPPPPHDRST 278 ++ + H PR + +N Y+ DTI H+ PPPPP T Sbjct: 148 QKSQVVHGPRGESLIDNQRKRYNYEDVDTIPTTKHKAPPPPPPTAET 194
>GSTF2_WHEAT (P30111) Glutathione S-transferase 2 (EC 2.5.1.18) (GST class-phi)| Length = 291 Score = 29.3 bits (64), Expect = 2.7 Identities = 14/35 (40%), Positives = 16/35 (45%) Frame = -2 Query: 260 WWWWLLVRAYVDRVSAAHAVIVFKSAVSPRCVCLP 156 WW L+ R V RV H FK RC+C P Sbjct: 202 WWEMLMARPAVQRV-CKHMPTEFKLRARTRCLCTP 235
>YQ5C_CAEEL (Q09466) Putative ABC transporter C16C10.12 in chromosome III| Length = 610 Score = 28.9 bits (63), Expect = 3.5 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +2 Query: 26 NNLHTYARWIKWRAWYWYNAKG 91 NN Y RW++W +W Y +G Sbjct: 526 NNFPVYIRWMQWTSWCRYGFEG 547
>NONO_PONPY (Q5RFL9) Non-POU domain-containing octamer-binding protein (NonO| protein) Length = 471 Score = 28.5 bits (62), Expect = 4.6 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +3 Query: 156 RQAHTPRRDGRFENYYSVRGRDTIHVRAHQQPPPPP 263 +Q HTPR+ ++ + H + QQPPPPP Sbjct: 11 KQNHTPRK------HHQHHHQQQHHQQQQQQPPPPP 40
>NONO_HUMAN (Q15233) Non-POU domain-containing octamer-binding protein (NonO| protein) (54 kDa nuclear RNA- and DNA-binding protein) (p54(nrb)) (p54nrb) (55 kDa nuclear protein) (NMT55) (DNA-binding p52/p100 complex, 52 kDa subunit) Length = 471 Score = 28.5 bits (62), Expect = 4.6 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +3 Query: 156 RQAHTPRRDGRFENYYSVRGRDTIHVRAHQQPPPPP 263 +Q HTPR+ ++ + H + QQPPPPP Sbjct: 11 KQNHTPRK------HHQHHHQQQHHQQQQQQPPPPP 40
>HYIN1_AGRVI (Q04557) Indoleacetamide hydrolase (EC 3.5.1.-) (IAH)| (Indole-3-acetamide hydrolase) Length = 462 Score = 28.1 bits (61), Expect = 6.0 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +3 Query: 147 RRCRQAHTPRRDGRFENYYSVRGRDTI 227 RR + + PR +ENYYS G D + Sbjct: 346 RRALRCYKPRLKATYENYYSSNGLDAV 372
>RPOC_STRR6 (Q8DNF1) DNA-directed RNA polymerase beta' chain (EC 2.7.7.6) (RNAP| beta' subunit) (Transcriptase beta' chain) (RNA polymerase beta' subunit) Length = 1225 Score = 27.7 bits (60), Expect = 7.9 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = -1 Query: 108 AVLLSLPFALYQYHARHLIQRAYVCKLLLRRDDDRI 1 A+ L PF + + AR ++Q K L+ R D+RI Sbjct: 363 AIELFKPFVMREIVARDIVQNVKAAKRLVERGDERI 398
>RPOC_STRPN (Q97NQ8) DNA-directed RNA polymerase beta' chain (EC 2.7.7.6) (RNAP| beta' subunit) (Transcriptase beta' chain) (RNA polymerase beta' subunit) Length = 1225 Score = 27.7 bits (60), Expect = 7.9 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = -1 Query: 108 AVLLSLPFALYQYHARHLIQRAYVCKLLLRRDDDRI 1 A+ L PF + + AR ++Q K L+ R D+RI Sbjct: 363 AIELFKPFVMREIVARDIVQNVKAAKRLVERGDERI 398
>NO75_LUPLU (Q06841) Early nodulin 75 protein (N-75) (NGM-75) (Fragment)| Length = 434 Score = 27.7 bits (60), Expect = 7.9 Identities = 10/22 (45%), Positives = 16/22 (72%), Gaps = 3/22 (13%) Frame = +3 Query: 225 IHVRAHQQPP---PPPHDRSTM 281 +H +H++PP PPPH++S M Sbjct: 267 VHPPSHEKPPFVYPPPHEKSPM 288
>AGLU_SPIOL (O04893) Alpha-glucosidase precursor (EC 3.2.1.20) (Maltase)| Length = 903 Score = 27.7 bits (60), Expect = 7.9 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +3 Query: 240 HQQPPPPPHDRSTM 281 HQ PPPPPH S++ Sbjct: 109 HQPPPPPPHSLSSL 122 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,810,501 Number of Sequences: 219361 Number of extensions: 828640 Number of successful extensions: 4390 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 3329 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3959 length of database: 80,573,946 effective HSP length: 69 effective length of database: 65,438,037 effective search space used: 1570512888 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)