| Clone Name | rbaet38g11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | VLPD_MYCHR (Q49536) Variant surface antigen D precursor (VLPD pr... | 28 | 7.1 | 2 | NRF1_MOUSE (Q9WU00) Nuclear respiratory factor 1 (NRF-1) (Alpha ... | 28 | 9.2 | 3 | NRF1_HUMAN (Q16656) Nuclear respiratory factor 1 (NRF-1) (Alpha ... | 28 | 9.2 |
|---|
>VLPD_MYCHR (Q49536) Variant surface antigen D precursor (VLPD prolipoprotein)| Length = 168 Score = 28.5 bits (62), Expect = 7.1 Identities = 18/61 (29%), Positives = 31/61 (50%) Frame = +2 Query: 86 QTSTTN*KQEN*TNPSNAMLLFRAGSNSTASSKEQASEQLTSLTGSPSGYCS*AARTRQG 265 Q+ +T+ +E ++ S + + S+ST++SKEQ S TS + S + QG Sbjct: 84 QSDSTSTSKEQGSSDSTSTSKEQGSSDSTSTSKEQGSSDSTSTSKEQGSSDSTSTSKEQG 143 Query: 266 S 268 S Sbjct: 144 S 144
>NRF1_MOUSE (Q9WU00) Nuclear respiratory factor 1 (NRF-1) (Alpha| palindromic-binding protein) (Alpha-pal) Length = 503 Score = 28.1 bits (61), Expect = 9.2 Identities = 18/75 (24%), Positives = 33/75 (44%) Frame = +2 Query: 11 ENFLYASLFDTTDQSIQRIINHRLQQTSTTN*KQEN*TNPSNAMLLFRAGSNSTASSKEQ 190 E+ LYA F+ Q H + + + +NP + L + G+ +T ++ Sbjct: 276 EDLLYA--FEDQQTQTQATTTHSIAHLVPSQTVVQTFSNPDGTVSLIQVGTGATVATLAD 333 Query: 191 ASEQLTSLTGSPSGY 235 ASE T++T + Y Sbjct: 334 ASELPTTVTVAQVNY 348
>NRF1_HUMAN (Q16656) Nuclear respiratory factor 1 (NRF-1) (Alpha| palindromic-binding protein) (Alpha-pal) Length = 503 Score = 28.1 bits (61), Expect = 9.2 Identities = 18/75 (24%), Positives = 33/75 (44%) Frame = +2 Query: 11 ENFLYASLFDTTDQSIQRIINHRLQQTSTTN*KQEN*TNPSNAMLLFRAGSNSTASSKEQ 190 E+ LYA F+ Q H + + + +NP + L + G+ +T ++ Sbjct: 276 EDLLYA--FEDQQTQTQATATHSIAHLVPSQTVVQTFSNPDGTVSLIQVGTGATVATLAD 333 Query: 191 ASEQLTSLTGSPSGY 235 ASE T++T + Y Sbjct: 334 ASELPTTVTVAQVNY 348 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,478,754 Number of Sequences: 219361 Number of extensions: 575282 Number of successful extensions: 1475 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1449 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1472 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2395157885 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)