| Clone Name | rbaet38c09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | APG_ARATH (P40602) Anter-specific proline-rich protein APG precu... | 47 | 3e-05 | 2 | APG_BRANA (P40603) Anter-specific proline-rich protein APG (Prot... | 39 | 0.004 | 3 | DSH_DROME (P51140) Segment polarity protein dishevelled | 29 | 5.9 | 4 | LRFN4_MOUSE (Q80XU8) Leucine-rich repeat and fibronectin type-II... | 28 | 7.7 | 5 | FAD6E_BRAJU (Q39287) Omega-6 fatty acid desaturase, endoplasmic ... | 28 | 7.7 |
|---|
>APG_ARATH (P40602) Anter-specific proline-rich protein APG precursor| Length = 534 Score = 46.6 bits (109), Expect = 3e-05 Identities = 21/59 (35%), Positives = 32/59 (54%), Gaps = 1/59 (1%) Frame = -2 Query: 427 YNLITLITEHPEAAGFKDVASACCGGGRLRAQTWCSPNAT-YCANRNDHVYWDEVHGTQ 254 Y +I+ + E P A GF++ CC G L A C + + C N + +++WD VH TQ Sbjct: 456 YTIISQMLETPAAYGFEETKKPCCKTGLLSAGALCKKSTSKICPNTSSYLFWDGVHPTQ 514
>APG_BRANA (P40603) Anter-specific proline-rich protein APG (Protein CEX)| (Fragment) Length = 449 Score = 39.3 bits (90), Expect = 0.004 Identities = 16/62 (25%), Positives = 32/62 (51%), Gaps = 1/62 (1%) Frame = -2 Query: 436 GSSYNLITLITEHPEAAGFKDVASACCGGGRLRAQTWCSPNA-TYCANRNDHVYWDEVHG 260 G Y++ + + E PE GF+++ CC G + +C +N + +++WD +H Sbjct: 370 GDIYSIFSKMLESPEDYGFEEIKKPCCKIGLTKGGVFCKERTLKNMSNASSYLFWDGLHP 429 Query: 259 TQ 254 +Q Sbjct: 430 SQ 431
>DSH_DROME (P51140) Segment polarity protein dishevelled| Length = 623 Score = 28.9 bits (63), Expect = 5.9 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -1 Query: 311 HLLRQSQRPCVLGRGAWHPGHLQQGRQGH 225 +++ + + P +LGRG HP L G GH Sbjct: 474 YVVNEERNPNLLGRGHLHPHQLPHGHGGH 502
>LRFN4_MOUSE (Q80XU8) Leucine-rich repeat and fibronectin type-III| domain-containing protein 4 precursor Length = 636 Score = 28.5 bits (62), Expect = 7.7 Identities = 20/88 (22%), Positives = 34/88 (38%) Frame = +3 Query: 30 FYCISIDPQKESKRRVSTSFLLLSIKSKLTTDGGRAIMHRSPI*EETSCLKLMGAAKPSF 209 + CI+ +P E+ RV L L + +GGR + +A+ + Sbjct: 349 YTCIATNPAGEATARVELRVLALPHGGNTSAEGGR-----------PGPSDIAASARTAA 397 Query: 210 TGAAKMALAPLLEVAWVPCTSSQYTWSL 293 G + P ++V V TS +W L Sbjct: 398 EGEGTLESEPAVQVTEVTATSGLVSWGL 425
>FAD6E_BRAJU (Q39287) Omega-6 fatty acid desaturase, endoplasmic reticulum (EC| 1.14.19.-) (Delta-12 desaturase) Length = 384 Score = 28.5 bits (62), Expect = 7.7 Identities = 20/60 (33%), Positives = 27/60 (45%), Gaps = 1/60 (1%) Frame = +3 Query: 126 GGRAIMHRSPI*EETSCLKLMGAAKPSFT-GAAKMALAPLLEVAWVPCTSSQYTWSLRLA 302 GGR + SP ET LK + P FT G K A+ P +P + S W + +A Sbjct: 4 GGRMQVSPSPKKSETDTLKRVPCETPPFTVGELKKAIPPHCFKRSIPRSFSYLIWDIIVA 63 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,365,563 Number of Sequences: 219361 Number of extensions: 925144 Number of successful extensions: 2816 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2701 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2814 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2618960580 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)