ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbaet37e08 |
|---|---|
| Clone Library Name | barley_pub |
>PIP13_ORYSA (Q9SXF8) Aquaporin PIP 1.3 (Plasma membrane intrinsic protein 1.3)| (OsPIP1.3) (Water channel protein RWC3) (RWC-3) Length = 288 Score = 39.7 bits (91), Expect = 0.002 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -3 Query: 397 ALAAIYHVVVIRAIPFKSR 341 ALAAIYHVVVIRAIPFKSR Sbjct: 269 ALAAIYHVVVIRAIPFKSR 287
>PIP11_VICFA (P61838) Aquaporin PIP1.1 (Plasma membrane intrinsic protein 1a)| (PIP1a) (Aquaporin 1) (Plasma membrane aquaporin 1) Length = 286 Score = 38.9 bits (89), Expect = 0.003 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = -3 Query: 397 ALAAIYHVVVIRAIPFKSR 341 ALAA+YHVVVIRAIPFKSR Sbjct: 267 ALAALYHVVVIRAIPFKSR 285
>PIP11_ARATH (P61837) Aquaporin PIP1.1 (Plasma membrane intrinsic protein 1a)| (PIP1a) (Aquaporin 1) (Plasma membrane aquaporin 1) Length = 286 Score = 38.9 bits (89), Expect = 0.003 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = -3 Query: 397 ALAAIYHVVVIRAIPFKSR 341 ALAA+YHVVVIRAIPFKSR Sbjct: 267 ALAALYHVVVIRAIPFKSR 285
>PIP12_ARATH (Q06611) Aquaporin PIP1.2 (Plasma membrane intrinsic protein 1b)| (PIP1b) (Transmembrane protein A) (TMP-A) (AthH2) Length = 286 Score = 38.5 bits (88), Expect = 0.004 Identities = 17/19 (89%), Positives = 19/19 (100%) Frame = -3 Query: 397 ALAAIYHVVVIRAIPFKSR 341 ALAA+YHV+VIRAIPFKSR Sbjct: 267 ALAALYHVIVIRAIPFKSR 285
>PIP12_ORYSA (Q7XSQ9) Probable aquaporin PIP1.2 (Plasma membrane intrinsic| protein 1.2) (OsPIP1.2) Length = 282 Score = 37.4 bits (85), Expect = 0.009 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 397 ALAAIYHVVVIRAIPFKSR 341 ALAAIYH VVIRAIPFKSR Sbjct: 263 ALAAIYHQVVIRAIPFKSR 281
>PIP11_ORYSA (Q6EU94) Aquaporin PIP1.1 (Plasma membrane intrinsic protein 1a)| (PIP1a) (OsPIP1.1) (Water channel protein RWC1) (RWC-1) Length = 289 Score = 37.0 bits (84), Expect = 0.011 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -3 Query: 397 ALAAIYHVVVIRAIPFKSR 341 ALAAIYH V+IRAIPFKSR Sbjct: 270 ALAAIYHQVIIRAIPFKSR 288
>LAS17_YEAST (Q12446) Proline-rich protein LAS17| Length = 633 Score = 36.6 bits (83), Expect = 0.015 Identities = 18/57 (31%), Positives = 28/57 (49%), Gaps = 3/57 (5%) Frame = +1 Query: 154 RRCRQAHTPRRDGRFENY---YSVRGRDTIHVRAHQQPPPPPHDRSTMNSDKIPSMA 315 ++ + H PR + +N Y+ DTI H+ PPPPP T +SD+ S + Sbjct: 148 QKSQVVHGPRGESLIDNQRKRYNYEDVDTIPTTKHKAPPPPPPTAETFDSDQTSSFS 204
>PIP2_PEA (P25794) Probable aquaporin PIP-type 7a (Turgor-responsive protein| 7a) (Turgor-responsive protein 31) Length = 289 Score = 35.4 bits (80), Expect = 0.033 Identities = 16/19 (84%), Positives = 18/19 (94%) Frame = -3 Query: 397 ALAAIYHVVVIRAIPFKSR 341 ALAA+YH VVIRAIPFKS+ Sbjct: 271 ALAALYHQVVIRAIPFKSK 289
>PIP13_ARATH (Q08733) Aquaporin PIP1.3 (Plasma membrane intrinsic protein 1c)| (PIP1c) (Transmembrane protein B) (TMP-B) Length = 286 Score = 35.4 bits (80), Expect = 0.033 Identities = 16/19 (84%), Positives = 18/19 (94%) Frame = -3 Query: 397 ALAAIYHVVVIRAIPFKSR 341 ALAA+YH +VIRAIPFKSR Sbjct: 267 ALAALYHQLVIRAIPFKSR 285
>PIP15_ARATH (Q8LAA6) Probable aquaporin PIP1.5 (Plasma membrane intrinsic| protein 1d) (PIP1d) Length = 287 Score = 35.0 bits (79), Expect = 0.043 Identities = 15/19 (78%), Positives = 18/19 (94%) Frame = -3 Query: 397 ALAAIYHVVVIRAIPFKSR 341 ALAA+YH +VIRAIPFKS+ Sbjct: 268 ALAALYHQIVIRAIPFKSK 286
>PIP14_ARATH (Q39196) Probable aquaporin PIP1.4 (Plasma membrane intrinsic| protein 1.4) (Transmembrane protein C) (TMP-C) Length = 287 Score = 35.0 bits (79), Expect = 0.043 Identities = 15/19 (78%), Positives = 18/19 (94%) Frame = -3 Query: 397 ALAAIYHVVVIRAIPFKSR 341 ALAA+YH +VIRAIPFKS+ Sbjct: 268 ALAALYHQIVIRAIPFKSK 286
>INADL_MOUSE (Q63ZW7) InaD-like protein (Inadl protein) (Pals1-associated tight| junction protein) (Protein associated to tight junctions) (Channel-interacting PDZ domain-containing protein) Length = 1834 Score = 31.6 bits (70), Expect = 0.48 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 235 HVRAHQQPPPPPHDRSTMNSDKIPSMAAQTDW 330 H+RA + PPPPH R + + + A T W Sbjct: 882 HLRAMESNPPPPHIREAAPASPVLELQAGTQW 913
>PIP1_LYCES (Q08451) Probable aquaporin PIP-type pTOM75 (Ripening-associated| membrane protein) (RAMP) Length = 286 Score = 30.0 bits (66), Expect = 1.4 Identities = 12/16 (75%), Positives = 15/16 (93%) Frame = -3 Query: 397 ALAAIYHVVVIRAIPF 350 ALAAIYH ++IRA+PF Sbjct: 268 ALAAIYHQIIIRAMPF 283
>RS5_HALSA (Q9HPB4) 30S ribosomal protein S5P| Length = 212 Score = 29.6 bits (65), Expect = 1.8 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = -2 Query: 386 DLPRGGDQGDPLQEPRLVDQSVWAAMDGILSLFIVDRSCGGG 261 D+ D G PL+EP +VDQ + D +L + +V R G Sbjct: 24 DMSEALDTGLPLKEPEIVDQLLPGLDDEVLDINMVQRMTDSG 65
>RL4_HALMA (P12735) 50S ribosomal protein L4P (Hmal4) (Hl6)| Length = 246 Score = 28.5 bits (62), Expect = 4.0 Identities = 20/54 (37%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +1 Query: 166 QAHTPRRDGRFENY-YSVRGRDTIHVRAHQQPPPPPHDRSTMNSDKIPSMAAQT 324 QAH P++DGR +V+GR AH PP DRS +DK +A ++ Sbjct: 67 QAHVPKQDGRARRVPQAVKGRS-----AH--PPKTEKDRSLDLNDKERQLAVRS 113
>NONO_PONPY (Q5RFL9) Non-POU domain-containing octamer-binding protein (NonO| protein) Length = 471 Score = 28.5 bits (62), Expect = 4.0 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +1 Query: 163 RQAHTPRRDGRFENYYSVRGRDTIHVRAHQQPPPPP 270 +Q HTPR+ ++ + H + QQPPPPP Sbjct: 11 KQNHTPRK------HHQHHHQQQHHQQQQQQPPPPP 40
>NONO_HUMAN (Q15233) Non-POU domain-containing octamer-binding protein (NonO| protein) (54 kDa nuclear RNA- and DNA-binding protein) (p54(nrb)) (p54nrb) (55 kDa nuclear protein) (NMT55) (DNA-binding p52/p100 complex, 52 kDa subunit) Length = 471 Score = 28.5 bits (62), Expect = 4.0 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +1 Query: 163 RQAHTPRRDGRFENYYSVRGRDTIHVRAHQQPPPPP 270 +Q HTPR+ ++ + H + QQPPPPP Sbjct: 11 KQNHTPRK------HHQHHHQQQHHQQQQQQPPPPP 40
>KP58_DROME (Q9VPC0) Serine/threonine-protein kinase PITSLRE (EC 2.7.11.22)| (Cell division cycle 2-like) Length = 952 Score = 28.1 bits (61), Expect = 5.3 Identities = 14/43 (32%), Positives = 20/43 (46%) Frame = +2 Query: 236 TYARTSNHHHHHMIGRR*TAIRFHPWPPRLIGPLAAALEGDRP 364 +YA HHH H+ G R +H +P G + + GD P Sbjct: 135 SYAAHHYHHHQHLSGARAAPREYHSYPS---GYHSGSRHGDYP 174
>NPHP4_MOUSE (P59240) Nephrocystin-4 (Nephroretinin)| Length = 1425 Score = 28.1 bits (61), Expect = 5.3 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = -2 Query: 389 GDLPRGGDQGDPLQEPRLVDQSVWAAMDGILSLF 288 G LP GD GD L++PR + W D +L+ Sbjct: 219 GLLPPHGDTGDALRKPRFQKPTTWHLDDLFFTLY 252
>HYIN1_AGRVI (Q04557) Indoleacetamide hydrolase (EC 3.5.1.-) (IAH)| (Indole-3-acetamide hydrolase) Length = 462 Score = 28.1 bits (61), Expect = 5.3 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +1 Query: 154 RRCRQAHTPRRDGRFENYYSVRGRDTI 234 RR + + PR +ENYYS G D + Sbjct: 346 RRALRCYKPRLKATYENYYSSNGLDAV 372
>NO75_LUPLU (Q06841) Early nodulin 75 protein (N-75) (NGM-75) (Fragment)| Length = 434 Score = 28.1 bits (61), Expect = 5.3 Identities = 10/23 (43%), Positives = 17/23 (73%), Gaps = 3/23 (13%) Frame = +1 Query: 232 IHVRAHQQPP---PPPHDRSTMN 291 +H +H++PP PPPH++S M+ Sbjct: 267 VHPPSHEKPPFVYPPPHEKSPMH 289
>CD2L7_CAEEL (P46551) Putative cell division cycle 2-related protein kinase 7| (EC 2.7.11.22) Length = 730 Score = 24.6 bits (52), Expect(2) = 6.5 Identities = 10/40 (25%), Positives = 16/40 (40%) Frame = +2 Query: 152 GDAAGRHTHRGETADLRTITACAAETRSTYARTSNHHHHH 271 G + H+ R + T+S + +HHHHH Sbjct: 644 GSSGSGHSIRATSHPRAPTQPSTTTTKSNGSSNHHHHHHH 683 Score = 21.6 bits (44), Expect(2) = 6.5 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = +1 Query: 247 HQQPPPPPHDRSTMNS 294 H PPPPP +++ S Sbjct: 697 HAPPPPPPPTQASSTS 712
>GLB1_MAIZE (P15590) Globulin-1 S allele precursor (GLB1-S) (7S-like)| Length = 573 Score = 27.7 bits (60), Expect = 6.9 Identities = 15/44 (34%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = +2 Query: 197 LRTITACAAETRSTYARTSNHHHH--HMIGRR*TAIRFHPWPPR 322 L + CAA ++ NHHHH H GR PW R Sbjct: 9 LLAVLLCAAAAVASSWEDDNHHHHGGHKSGRCVRRCEDRPWHQR 52
>CYTSA_FUGRU (Q2KN94) Cytospin-A| Length = 1118 Score = 27.7 bits (60), Expect = 6.9 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -2 Query: 149 FKSASFSQYSTCCTTFPTFCIVPVPRTPFNPA 54 F SAS S + PT P+PRTP +P+ Sbjct: 837 FDSASQGPPSNGASVTPTVSAAPLPRTPLSPS 868
>CYTSA_TETNG (Q2KN95) Cytospin-A| Length = 1113 Score = 27.7 bits (60), Expect = 6.9 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -2 Query: 149 FKSASFSQYSTCCTTFPTFCIVPVPRTPFNPA 54 F SAS S+ + PT P+PRTP +P+ Sbjct: 832 FDSASQGPPSSGASVTPTASAAPLPRTPLSPS 863
>AGLU_SPIOL (O04893) Alpha-glucosidase precursor (EC 3.2.1.20) (Maltase)| Length = 903 Score = 27.7 bits (60), Expect = 6.9 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +1 Query: 247 HQQPPPPPHDRSTM 288 HQ PPPPPH S++ Sbjct: 109 HQPPPPPPHSLSSL 122
>BRPF1_HUMAN (P55201) Peregrin (Bromodomain and PHD finger-containing protein 1)| (BR140 protein) Length = 1214 Score = 27.7 bits (60), Expect = 6.9 Identities = 15/41 (36%), Positives = 19/41 (46%) Frame = +2 Query: 245 RTSNHHHHHMIGRR*TAIRFHPWPPRLIGPLAAALEGDRPD 367 + SNHHHHH + T P+L + LE D PD Sbjct: 158 KDSNHHHHHNVSASTT--------PKLPEVVYRELEQDTPD 190
>RN139_MOUSE (Q7TMV1) RING finger protein 139| Length = 668 Score = 27.3 bits (59), Expect = 9.0 Identities = 13/31 (41%), Positives = 19/31 (61%), Gaps = 3/31 (9%) Frame = -2 Query: 362 GDPLQEPRLVDQSVWAAMDGIL---SLFIVD 279 G P Q+ R+ Q VWAA++ L L+I+D Sbjct: 5 GPPQQQVRMAQQQVWAALEVALRVPCLYIID 35
>ZO3_CANFA (O62683) Tight junction protein ZO-3 (Zonula occludens 3 protein)| (Zona occludens 3 protein) (Tight junction protein 3) Length = 898 Score = 27.3 bits (59), Expect = 9.0 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = +1 Query: 187 DGRFENYYSVRGRDTIHVRAHQQPPPPPHDRSTMNSD 297 D F + S G + PPPPPH + +++SD Sbjct: 281 DSSFLDDISALGSELSQAVPSHVPPPPPHAQRSLDSD 317
>I17RA_HUMAN (Q96F46) Interleukin-17 receptor A precursor (IL-17 receptor)| Length = 866 Score = 27.3 bits (59), Expect = 9.0 Identities = 17/46 (36%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = -2 Query: 386 DLPRGGDQGDPLQEPRLVDQSVWAAMDGI-LSLFIVDRSCGGGGGC 252 D P G P+ P L+ + V ++G+ LSLF SC GGC Sbjct: 725 DSPLGSST--PMASPDLLPEDVREHLEGLMLSLFEQSLSCQAQGGC 768
>NRIP1_MOUSE (Q8CBD1) Nuclear receptor-interacting protein 1 (Nuclear factor| RIP140) (Receptor-interacting protein 140) Length = 1161 Score = 27.3 bits (59), Expect = 9.0 Identities = 21/60 (35%), Positives = 27/60 (45%), Gaps = 1/60 (1%) Frame = -3 Query: 232 SCLGRARCNSSQI-CRLSSVCVPAGSVACSSLRVSVSIVPAVLLSLPFALYQYHARHLIQ 56 SC R + +S + R S P SVACS L A+LLS L QY H ++ Sbjct: 236 SCAARLQAVASMVEKRASPAASPKPSVACSQL--------ALLLSSEAHLQQYSREHALK 287
>MEOX2_HUMAN (P50222) Homeobox protein MOX-2 (Mesenchyme homeobox 2) (Growth| arrest-specific homeobox) Length = 304 Score = 23.5 bits (49), Expect(2) = 9.1 Identities = 10/31 (32%), Positives = 19/31 (61%) Frame = +2 Query: 254 NHHHHHMIGRR*TAIRFHPWPPRLIGPLAAA 346 +HHHHH ++ A++ + P++ P +AA Sbjct: 74 HHHHHHHQQQQHQALQTNWHLPQMSSPPSAA 104 Score = 22.3 bits (46), Expect(2) = 9.1 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +2 Query: 233 STYARTSNHHHHH 271 S + R +HHHHH Sbjct: 62 SQHHRGHHHHHHH 74
>MEOX2_RAT (P39020) Homeobox protein MOX-2 (Growth arrest-specific homeobox)| Length = 303 Score = 23.5 bits (49), Expect(2) = 9.1 Identities = 10/31 (32%), Positives = 19/31 (61%) Frame = +2 Query: 254 NHHHHHMIGRR*TAIRFHPWPPRLIGPLAAA 346 +HHHHH ++ A++ + P++ P +AA Sbjct: 73 HHHHHHHQQQQHQALQSNWHLPQMSSPPSAA 103 Score = 22.3 bits (46), Expect(2) = 9.1 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +2 Query: 233 STYARTSNHHHHH 271 S + R +HHHHH Sbjct: 62 SQHHRGHHHHHHH 74
>MEOX2_MOUSE (P32443) Homeobox protein MOX-2 (Mesenchyme homeobox 2)| Length = 303 Score = 23.5 bits (49), Expect(2) = 9.1 Identities = 10/31 (32%), Positives = 19/31 (61%) Frame = +2 Query: 254 NHHHHHMIGRR*TAIRFHPWPPRLIGPLAAA 346 +HHHHH ++ A++ + P++ P +AA Sbjct: 73 HHHHHHHQQQQHQALQSNWHLPQMSSPPSAA 103 Score = 22.3 bits (46), Expect(2) = 9.1 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +2 Query: 233 STYARTSNHHHHH 271 S + R +HHHHH Sbjct: 62 SQHHRGHHHHHHH 74 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,551,400 Number of Sequences: 219361 Number of extensions: 1186260 Number of successful extensions: 5606 Number of sequences better than 10.0: 34 Number of HSP's better than 10.0 without gapping: 4354 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5111 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 1365190992 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
