ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbaet35b01 |
|---|---|
| Clone Library Name | barley_pub |
>FBN3_HUMAN (Q75N90) Fibrillin-3 precursor| Length = 2809 Score = 30.8 bits (68), Expect = 0.83 Identities = 19/51 (37%), Positives = 27/51 (52%) Frame = -2 Query: 186 YSPEPRQRTCM*SHQCSVVV*YCSLLCKSSKVVSGSALFN*ISAPAAILLQ 34 Y+P+ TC+ +CS V C+ LCK++K GS L S P LL+ Sbjct: 2394 YTPDATATTCLDMDECSQVPKPCTFLCKNTK---GSFL---CSCPRGYLLE 2438
>PGS1_HORSE (O46403) Biglycan precursor (Bone/cartilage proteoglycan I) (PG-S1)| Length = 372 Score = 30.0 bits (66), Expect = 1.4 Identities = 17/35 (48%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Frame = +2 Query: 17 CHV-VLNCSKIAAGAEI*LKRALPETTLLDLHNNE 118 CH+ V+ CS + G + K P+TTLLDL NNE Sbjct: 73 CHLRVVQCSDL--GLKAVPKEISPDTTLLDLQNNE 105
>PAK1_YEAST (P38990) Serine/threonine-protein kinase PAK1 (EC 2.7.11.1)| Length = 1142 Score = 29.6 bits (65), Expect = 1.9 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +1 Query: 187 QSKSKSSTSNLEDKLEFHGNTDDGK 261 Q K+ + TSNL D +EF+GN D K Sbjct: 1022 QKKATTETSNLTDIVEFNGNNDHRK 1046
>TEGU_HHV11 (P10220) Large tegument protein (Virion protein UL36)| Length = 3164 Score = 29.3 bits (64), Expect = 2.4 Identities = 24/88 (27%), Positives = 39/88 (44%), Gaps = 5/88 (5%) Frame = -3 Query: 365 QDQVLSCCYKERCHPNPKSKLRVLSEFLSDGGGP----LFPSSVLPWNSNLSSKFDVXXX 198 Q+ S + +R P+P +++RVL F S GG P +F + + W S+ D Sbjct: 2168 QNAADSMLFVQRLTPHPDARIRVLPAF-SAGGPPTRGLMFGTRLADWRRGKLSETDPLAP 2226 Query: 197 XXLCIHLNPDRGLVCNLIS-AQLLCSTA 117 L +RG +S AQ L + + Sbjct: 2227 WRSVPELGTERGAALGKLSPAQALAAVS 2254
>PTN13_HUMAN (Q12923) Tyrosine-protein phosphatase non-receptor type 13 (EC| 3.1.3.48) (Protein-tyrosine phosphatase 1E) (PTP-E1) (hPTPE1) (PTP-BAS) (Protein-tyrosine phosphatase PTPL1) (Fas-associated protein-tyrosine phosphatase 1) (FAP-1) Length = 2485 Score = 28.9 bits (63), Expect = 3.2 Identities = 13/50 (26%), Positives = 25/50 (50%), Gaps = 3/50 (6%) Frame = +2 Query: 173 GSGE---YRARARVAHQTWKTNWNSTVTRTMGREGRHHQKEIHSEHAVCS 313 GSGE A A +++ TW + + T++ + + HH+ E +C+ Sbjct: 1657 GSGEDDLVTAPANISNSTWSSALHQTLSNMVSQAQSHHEAPKSQEDTICT 1706
>EGFL8_HUMAN (Q99944) EGF-like domain-containing protein 8 precursor (Epidermal| growth factor-like protein 8) (Multiple EGF-like domain protein 8) (Vascular endothelial-statin 2) (VE-statin-2) Length = 293 Score = 28.9 bits (63), Expect = 3.2 Identities = 25/79 (31%), Positives = 34/79 (43%) Frame = +2 Query: 86 ETTLLDLHNNEQYYTTTEH**DYIQVLCLGSGEYRARARVAHQTWKTNWNSTVTRTMGRE 265 +T ++ LH NE Y Y L L +G R T++T + R M RE Sbjct: 41 QTLVVPLHYNESYSQPV-----YKPYLTLCAG------RRICSTYRTMY-----RVMWRE 84 Query: 266 GRHHQKEIHSEHAVCSSGW 322 R +E+ HAVC GW Sbjct: 85 VR---REVQQTHAVCCQGW 100
>UNG_BIFLO (Q8G3E9) Uracil-DNA glycosylase (EC 3.2.2.-) (UDG)| Length = 213 Score = 28.9 bits (63), Expect = 3.2 Identities = 15/40 (37%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = -3 Query: 353 LSCCYKERCHPNPKSKLRVLSEFLSDGGGPLFPSSVL-PW 237 LS C HP PKS + + E + D G P+ + L PW Sbjct: 62 LSFCVAPNVHPLPKSLVNIYKELVDDLGVPMPTNGDLTPW 101
>PGS1_PIG (Q9GKQ6) Biglycan precursor (Bone/cartilage proteoglycan I) (PG-S1)| (Fragments) Length = 272 Score = 28.9 bits (63), Expect = 3.2 Identities = 16/35 (45%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Frame = +2 Query: 17 CHV-VLNCSKIAAGAEI*LKRALPETTLLDLHNNE 118 CH+ V+ CS + G + K P+TTLLDL NN+ Sbjct: 70 CHLRVVQCSDL--GLKAVPKEISPDTTLLDLQNND 102
>HIS5_THIDN (Q30PY0) Imidazole glycerol phosphate synthase subunit hisH (EC| 2.4.2.-) (IGP synthase glutamine amidotransferase subunit) (IGP synthase subunit hisH) (ImGP synthase subunit hisH) (IGPS subunit hisH) Length = 207 Score = 28.9 bits (63), Expect = 3.2 Identities = 13/58 (22%), Positives = 24/58 (41%) Frame = +2 Query: 158 QVLCLGSGEYRARARVAHQTWKTNWNSTVTRTMGREGRHHQKEIHSEHAVCSSGWDGI 331 +V+ + ++ +V H W + G + H+ +HS HA+C D I Sbjct: 104 KVVAFDTSKFEETLKVPHMGWNRMFTKEHPLFEGLDEEHYLYFVHSYHALCDDEKDSI 161
>PGS1_SHEEP (O46390) Biglycan precursor (Bone/cartilage proteoglycan I) (PG-S1)| Length = 369 Score = 28.9 bits (63), Expect = 3.2 Identities = 16/35 (45%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Frame = +2 Query: 17 CHV-VLNCSKIAAGAEI*LKRALPETTLLDLHNNE 118 CH+ V+ CS + G + K P+TTLLDL NN+ Sbjct: 70 CHLRVVQCSDL--GLKAVPKEISPDTTLLDLQNND 102
>PGS1_RAT (P47853) Biglycan precursor (Bone/cartilage proteoglycan I) (PG-S1)| Length = 369 Score = 28.9 bits (63), Expect = 3.2 Identities = 16/35 (45%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Frame = +2 Query: 17 CHV-VLNCSKIAAGAEI*LKRALPETTLLDLHNNE 118 CH+ V+ CS + G + K P+TTLLDL NN+ Sbjct: 70 CHLRVVQCSDL--GLKTVPKEISPDTTLLDLQNND 102
>PGS1_MOUSE (P28653) Biglycan precursor (Bone/cartilage proteoglycan I) (PG-S1)| Length = 369 Score = 28.9 bits (63), Expect = 3.2 Identities = 16/35 (45%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Frame = +2 Query: 17 CHV-VLNCSKIAAGAEI*LKRALPETTLLDLHNNE 118 CH+ V+ CS + G + K P+TTLLDL NN+ Sbjct: 70 CHLRVVQCSDL--GLKTVPKEISPDTTLLDLQNND 102
>PGS1_BOVIN (P21809) Biglycan precursor (Bone/cartilage proteoglycan I) (PG-S1)| (Leucine-rich PG I) Length = 369 Score = 28.9 bits (63), Expect = 3.2 Identities = 16/35 (45%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Frame = +2 Query: 17 CHV-VLNCSKIAAGAEI*LKRALPETTLLDLHNNE 118 CH+ V+ CS + G + K P+TTLLDL NN+ Sbjct: 70 CHLRVVQCSDL--GLKAVPKEISPDTTLLDLQNND 102
>VE2_PAPVE (P11329) Probable regulatory protein E2| Length = 415 Score = 28.5 bits (62), Expect = 4.1 Identities = 14/46 (30%), Positives = 23/46 (50%) Frame = +2 Query: 206 AHQTWKTNWNSTVTRTMGREGRHHQKEIHSEHAVCSSGWDGIFLCS 343 +++TW T W++ R EG E AVC++ GI+ C+ Sbjct: 128 SNKTWYTAWSTVYVRGTEEEG--------WETAVCAADGQGIYYCA 165
>PGS1_HUMAN (P21810) Biglycan precursor (Bone/cartilage proteoglycan I) (PG-S1)| Length = 368 Score = 28.5 bits (62), Expect = 4.1 Identities = 16/35 (45%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Frame = +2 Query: 17 CHV-VLNCSKIAAGAEI*LKRALPETTLLDLHNNE 118 CH+ V+ CS + G + K P+TTLLDL NN+ Sbjct: 69 CHLRVVQCSDL--GLKSVPKEISPDTTLLDLQNND 101
>PGS2_COTJA (Q9DE68) Decorin precursor (Bone proteoglycan II) (PG-S2)| Length = 356 Score = 28.1 bits (61), Expect = 5.4 Identities = 17/35 (48%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Frame = +2 Query: 17 CHV-VLNCSKIAAGAEI*LKRALPETTLLDLHNNE 118 CH+ V+ CS + G E K P+TTLLDL NN+ Sbjct: 57 CHLRVVQCSDL--GLERVPKDLPPDTTLLDLQNNK 89
>PGS2_CHICK (P28675) Decorin precursor (Bone proteoglycan II) (PG-S2)| Length = 357 Score = 28.1 bits (61), Expect = 5.4 Identities = 17/35 (48%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Frame = +2 Query: 17 CHV-VLNCSKIAAGAEI*LKRALPETTLLDLHNNE 118 CH+ V+ CS + G E K P+TTLLDL NN+ Sbjct: 58 CHLRVVQCSDL--GLERVPKDLPPDTTLLDLQNNK 90
>VC03_SWPVK (P32229) G-protein coupled receptor homolog C3| Length = 269 Score = 27.7 bits (60), Expect = 7.0 Identities = 18/61 (29%), Positives = 29/61 (47%) Frame = -3 Query: 188 CIHLNPDRGLVCNLISAQLLCSTARCCANPAKLFQVVPSSIRFQPRLLSCCSSVQHDKLS 9 C++LN + I+ S ARCC NP ++ ++ +R R+ S CS + D Sbjct: 202 CLYLN-----LAYAITFSETISLARCCINPI-IYTLIGEHVR--SRISSICSCIYRDNRI 253 Query: 8 R 6 R Sbjct: 254 R 254
>K0256_HUMAN (Q93073) Protein KIAA0256| Length = 1101 Score = 27.7 bits (60), Expect = 7.0 Identities = 10/36 (27%), Positives = 21/36 (58%) Frame = +2 Query: 197 ARVAHQTWKTNWNSTVTRTMGREGRHHQKEIHSEHA 304 + V + ++TNW + V + G E ++KE+ +H+ Sbjct: 867 SEVNEKEYETNWRNMVETSDGLEASENEKEVSCKHS 902
>CRIM1_HUMAN (Q9NZV1) Cysteine-rich motor neuron 1 protein precursor (CRIM-1)| (Cysteine-rich repeat-containing protein S52) Length = 1036 Score = 27.7 bits (60), Expect = 7.0 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = -3 Query: 155 CNLISAQLLCSTARCCANP 99 CN+I+ + C+T R C+NP Sbjct: 133 CNIINGKCECNTIRTCSNP 151
>VK02_SWPVK (Q08520) G-protein coupled receptor homolog K2| Length = 370 Score = 27.7 bits (60), Expect = 7.0 Identities = 18/61 (29%), Positives = 29/61 (47%) Frame = -3 Query: 188 CIHLNPDRGLVCNLISAQLLCSTARCCANPAKLFQVVPSSIRFQPRLLSCCSSVQHDKLS 9 C++LN + I+ S ARCC NP ++ ++ +R R+ S CS + D Sbjct: 303 CLYLN-----LAYAITFSETISLARCCINPI-IYTLIGEHVR--SRISSICSCIYRDNRI 354 Query: 8 R 6 R Sbjct: 355 R 355
>RAE1_SCHPO (P41838) Poly(A)+ RNA export protein| Length = 352 Score = 27.3 bits (59), Expect = 9.2 Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 6/51 (11%) Frame = -3 Query: 173 PDRGLVCNLISAQLLCSTAR---CCAN---PAKLFQVVPSSIRFQPRLLSC 39 P+R + + L +TA C N P K+F++ S ++FQ R L+C Sbjct: 159 PERVYAMDCVHPLLTVATAERNICVINLSEPTKIFKLAMSPLKFQTRSLAC 209
>HEMH_WIGBR (Q8D226) Ferrochelatase (EC 4.99.1.1) (Protoheme ferro-lyase) (Heme| synthetase) Length = 321 Score = 27.3 bits (59), Expect = 9.2 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = -3 Query: 326 HPNPKSKLRVLSEFLSD 276 HPN KS + LSEFLSD Sbjct: 17 HPNKKSVKKYLSEFLSD 33 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,495,182 Number of Sequences: 219361 Number of extensions: 1062265 Number of successful extensions: 2891 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 2809 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2888 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 1402043640 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
