| Clone Name | rbaet34c11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | COP1_PEA (P93471) Ubiquitin ligase protein COP1 (EC 6.3.2.-) (Co... | 28 | 4.5 |
|---|
>COP1_PEA (P93471) Ubiquitin ligase protein COP1 (EC 6.3.2.-) (Constitutive| photomorphogenesis protein 1) Length = 672 Score = 28.5 bits (62), Expect = 4.5 Identities = 20/62 (32%), Positives = 31/62 (50%), Gaps = 6/62 (9%) Frame = +3 Query: 33 HVYIHERTTES---CAQMNAY---QHANDNYKVVIIIMGAWNKRN*KGMMEYKECKKDAS 194 H + E TT S C N Y Q A+ +Y+ ++ + W K +MEY+E +K A Sbjct: 408 HCPVVEMTTRSKLSCLSWNKYAKNQIASSDYEGIVTV---WTMTTRKSLMEYEEHEKRAW 464 Query: 195 SL 200 S+ Sbjct: 465 SV 466 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,806,860 Number of Sequences: 219361 Number of extensions: 796530 Number of successful extensions: 1665 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1646 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1665 length of database: 80,573,946 effective HSP length: 75 effective length of database: 64,121,871 effective search space used: 1538924904 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)