| Clone Name | rbaet32f04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TGFB3_CHICK (P16047) Transforming growth factor beta-3 precursor... | 28 | 5.2 | 2 | BCL9_MOUSE (Q9D219) B-cell lymphoma 9 protein (Bcl-9) | 28 | 5.2 | 3 | NLK_HUMAN (Q9UBE8) Serine/threonine kinase NLK (EC 2.7.11.24) (N... | 28 | 8.8 |
|---|
>TGFB3_CHICK (P16047) Transforming growth factor beta-3 precursor (TGF-beta-3)| Length = 412 Score = 28.5 bits (62), Expect = 5.2 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +3 Query: 27 LKNNQILHKPHFFRVHTPTHHLDSPS 104 LK + LH PH + P H L+SP+ Sbjct: 267 LKKQKDLHNPHLILMMLPPHRLESPT 292
>BCL9_MOUSE (Q9D219) B-cell lymphoma 9 protein (Bcl-9)| Length = 1425 Score = 28.5 bits (62), Expect = 5.2 Identities = 16/52 (30%), Positives = 29/52 (55%), Gaps = 1/52 (1%) Frame = +3 Query: 3 KKKDALINLKNNQILHKPHFFRVHTPTHHLDS-PSHAKSISPERHAAQQHPS 155 K+ ++ ++K+ + H PH T T S PSH ++ +PE +AQ+ P+ Sbjct: 123 KECNSADHIKSQESQHTPHSMTPSTATAPRSSTPSHGQTPAPEPISAQKTPA 174
>NLK_HUMAN (Q9UBE8) Serine/threonine kinase NLK (EC 2.7.11.24) (Nemo-like| kinase) (LAK1 protein) Length = 515 Score = 27.7 bits (60), Expect = 8.8 Identities = 16/43 (37%), Positives = 20/43 (46%) Frame = +3 Query: 45 LHKPHFFRVHTPTHHLDSPSHAKSISPERHAAQQHPSAMKLSA 173 L PH H P HHL P A ++ H QQH S+ +A Sbjct: 26 LPPPHLHHHHHPQHHL-HPGSAAAV----HPVQQHTSSAAAAA 63 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,616,565 Number of Sequences: 219361 Number of extensions: 458130 Number of successful extensions: 1337 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1307 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1336 length of database: 80,573,946 effective HSP length: 35 effective length of database: 72,896,311 effective search space used: 1749511464 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)