| Clone Name | rbaet31b01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RGS20_BOVIN (P79348) Regulator of G-protein signaling 20 (RGS20)... | 29 | 3.9 | 2 | ATM_CRYNE (Q5KFE0) Serine/threonine-protein kinase TEL1 (EC 2.7.... | 28 | 5.1 | 3 | ADA32_MOUSE (Q8K410) ADAM 32 precursor (A disintegrin and metall... | 28 | 8.7 |
|---|
>RGS20_BOVIN (P79348) Regulator of G-protein signaling 20 (RGS20)| (Retina-specific regulator of G-protein signaling) (RET-RGS1) Length = 374 Score = 28.9 bits (63), Expect = 3.9 Identities = 10/18 (55%), Positives = 13/18 (72%), Gaps = 2/18 (11%) Frame = +2 Query: 125 PRIQNQPNWAC--CWCCC 172 P ++NQ + AC CWCCC Sbjct: 183 PGVENQGSNACCFCWCCC 200
>ATM_CRYNE (Q5KFE0) Serine/threonine-protein kinase TEL1 (EC 2.7.11.1)| (DNA-damage checkpoint kinase TEL1) (Telomere length regulation protein 1) (ATM homolog) Length = 2967 Score = 28.5 bits (62), Expect = 5.1 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +3 Query: 69 MNKFCIIKHVSITFGGTCSPGFKTNQTGRAV 161 +N FC + + I GG+ +PG + NQ G A+ Sbjct: 1555 VNIFCQLGEIRIELGGSGTPGSQPNQMGDAL 1585
>ADA32_MOUSE (Q8K410) ADAM 32 precursor (A disintegrin and metalloprotease| domain 32) Length = 750 Score = 27.7 bits (60), Expect = 8.7 Identities = 13/47 (27%), Positives = 21/47 (44%) Frame = +3 Query: 3 TPTQKLHISCIYLPCSHKLRQKMNKFCIIKHVSITFGGTCSPGFKTN 143 +P+ +C +LP H+ R + + +C I V G C P N Sbjct: 432 SPSSTCCKNCQFLPEKHQCRPEKHLYCDIPEVCNGSSGNCPPDVTIN 478 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,160,725 Number of Sequences: 219361 Number of extensions: 556781 Number of successful extensions: 1541 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1489 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1537 length of database: 80,573,946 effective HSP length: 39 effective length of database: 72,018,867 effective search space used: 1728452808 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)