| Clone Name | rbaet30g11 |
|---|---|
| Clone Library Name | barley_pub |
>UL52_EBV (P03193) Helicase/primase complex protein (Probable DNA replication| protein BSLF1) Length = 874 Score = 30.8 bits (68), Expect = 0.87 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = -1 Query: 243 SKHVRTYVRRRTALAMHITHANVRTRMEHLLFFRWIGSP 127 ++H+RTY R T LA H+ ++ RME + W P Sbjct: 312 AEHMRTYFTRETYLAEHVRVQQLKIRMEPPAPYTWDPDP 350
>RECK_HUMAN (O95980) Reversion-inducing cysteine-rich protein with Kazal motifs| precursor (hRECK) (Suppressor of tumorigenicity 15) (ST15) Length = 971 Score = 28.5 bits (62), Expect = 4.3 Identities = 19/60 (31%), Positives = 31/60 (51%), Gaps = 7/60 (11%) Frame = -2 Query: 296 LSYCEFVVALPCQGSCTKAST-------YVRTYDDALHLPCISRMQTYVHAWNICYSFDG 138 L CE +AL C+ +C +AS+ + Y++AL CISR + ++C S+ G Sbjct: 102 LGCCELAIALECRQACKQASSKNDISKVCRKEYENAL-FSCISRNE----MGSVCCSYAG 156
>NUOA_BUCBP (Q89AU6) NADH-quinone oxidoreductase chain A (EC 1.6.99.5) (NADH| dehydrogenase I, chain A) (NDH-1, chain A) Length = 132 Score = 28.1 bits (61), Expect = 5.6 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = -2 Query: 104 WGFLAFFFVVIKTCVIMIML 45 W F FFF+ + CV M+ + Sbjct: 12 WAFFTFFFIAVSICVFMLSI 31
>IFRD1_MOUSE (P19182) Interferon-related developmental regulator 1 (Nerve growth| factor-inducible protein PC4) (TPA-induced sequence 7) (TIS7 protein) Length = 449 Score = 28.1 bits (61), Expect = 5.6 Identities = 11/40 (27%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = +2 Query: 188 VICM-ASAVRRRTYVRTCLLLCSYLDTGERPQIHNNLKCF 304 +IC A++++ R TC +C ++ T + ++++ L+CF Sbjct: 174 IICDGAASIQARQTCATCFGVCCFIATDDITELYSTLECF 213
>IFNG_RABIT (P30123) Interferon gamma precursor (IFN-gamma)| Length = 167 Score = 27.7 bits (60), Expect = 7.4 Identities = 10/23 (43%), Positives = 17/23 (73%) Frame = +3 Query: 210 CVVVRTYVRACFCAATLTRESDH 278 C+++ +Y C+C TLTRE++H Sbjct: 13 CLILGSY--GCYCQDTLTRETEH 33
>MATK_PSEMZ (Q9MV48) Maturase K (Intron maturase)| Length = 515 Score = 27.3 bits (59), Expect = 9.6 Identities = 18/53 (33%), Positives = 27/53 (50%), Gaps = 8/53 (15%) Frame = -1 Query: 225 YVR--RRTALAMHITHANVRTRMEHLLFFR------WIGSPHRMCTFYVGLSC 91 YVR R+ +A+ TH V+ HLL FR W P+R+C+ + +C Sbjct: 274 YVRYGERSIIAIKGTHLLVKKCRYHLLIFRQCYFHLWF-EPYRVCSHQLSKNC 325
>MATK_THUDO (Q9MSS0) Maturase K (Intron maturase)| Length = 509 Score = 27.3 bits (59), Expect = 9.6 Identities = 18/57 (31%), Positives = 27/57 (47%), Gaps = 7/57 (12%) Frame = -1 Query: 225 YVR--RRTALAMHITHANVRTRMEHLL-----FFRWIGSPHRMCTFYVGLSCFFFCG 76 YVR R+ +A+ TH V+ HL FF P+R+C+ + + F F G Sbjct: 275 YVRYGERSLIALKGTHLQVKKCRYHLFHFWQYFFHLWFQPYRICSLELSKTSFSFLG 331 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,868,926 Number of Sequences: 219361 Number of extensions: 985142 Number of successful extensions: 2234 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2155 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2229 length of database: 80,573,946 effective HSP length: 89 effective length of database: 61,050,817 effective search space used: 1465219608 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)