| Clone Name | rbaet30g10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | EAD_EBV (P03191) Early antigen protein D (EA-D) | 30 | 2.0 | 2 | UNC52_CAEEL (Q06561) Basement membrane proteoglycan precursor (P... | 30 | 2.0 | 3 | NBEA_MOUSE (Q9EPN1) Protein neurobeachin (Lysosomal trafficking ... | 29 | 3.5 | 4 | ITK_HUMAN (Q08881) Tyrosine-protein kinase ITK/TSK (EC 2.7.10.2)... | 28 | 4.5 |
|---|
>EAD_EBV (P03191) Early antigen protein D (EA-D)| Length = 404 Score = 29.6 bits (65), Expect = 2.0 Identities = 18/55 (32%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Frame = -3 Query: 301 TRLTKQSSHAVMPLPSEPTDRSTPLWKEP-DDVLATTTVVSLSDETTTETMLCYQ 140 T L ++ H V P PS P TP W+ P + + S S T E L Q Sbjct: 322 TGLQQRPRHTVSPSPSPPPPPRTPTWESPARPETPSPAIPSHSSNTALERPLAVQ 376
>UNC52_CAEEL (Q06561) Basement membrane proteoglycan precursor (Perlecan homolog)| (Uncoordinated protein 52) Length = 3375 Score = 29.6 bits (65), Expect = 2.0 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 2/51 (3%) Frame = -3 Query: 301 TRLTKQSSHAVM--PLPSEPTDRSTPLWKEPDDVLATTTVVSLSDETTTET 155 T T + AV+ P EPT P+ +EP + TT + ++E TT T Sbjct: 2974 TTTTTEEPEAVIEEPTTEEPTTTEEPITEEPTEEPTTTEEPTTTEEPTTTT 3024
>NBEA_MOUSE (Q9EPN1) Protein neurobeachin (Lysosomal trafficking regulator 2)| Length = 2936 Score = 28.9 bits (63), Expect = 3.5 Identities = 15/36 (41%), Positives = 21/36 (58%), Gaps = 2/36 (5%) Frame = -3 Query: 289 KQSSHAVMPLPSEPTDRS--TPLWKEPDDVLATTTV 188 K+ +HA++P+ DRS P+ K P LA TTV Sbjct: 1763 KREAHAILPMQFHSFDRSVVVPVKKPPPGSLAVTTV 1798
>ITK_HUMAN (Q08881) Tyrosine-protein kinase ITK/TSK (EC 2.7.10.2)| (T-cell-specific kinase) (Tyrosine-protein kinase Lyk) (Kinase EMT) Length = 620 Score = 28.5 bits (62), Expect = 4.5 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = -3 Query: 265 PLPSEPTDRSTPLWKEPDDVLATTTVVSLSDETTTE 158 PLP P D PLW EP++ T V++L D T + Sbjct: 156 PLPPTPEDNRRPLW-EPEE----TVVIALYDYQTND 186 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,537,918 Number of Sequences: 219361 Number of extensions: 456752 Number of successful extensions: 1136 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1096 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1136 length of database: 80,573,946 effective HSP length: 76 effective length of database: 63,902,510 effective search space used: 1533660240 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)