| Clone Name | rbaet30c02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PEX10_ARATH (Q9SYU4) Peroxisome assembly protein 10 (Peroxin-10)... | 30 | 1.5 |
|---|
>PEX10_ARATH (Q9SYU4) Peroxisome assembly protein 10 (Peroxin-10) (AthPEX10)| (Pex10p) (PER8) Length = 381 Score = 30.0 bits (66), Expect = 1.5 Identities = 16/31 (51%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = -1 Query: 308 PGRGGDSGGID-VELALQPEPMQRLEKDDEF 219 PG G GGI LA QPE M+ EKDD++ Sbjct: 14 PGSSGFHGGIRRFPLAAQPEIMRAAEKDDQY 44 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,635,995 Number of Sequences: 219361 Number of extensions: 628400 Number of successful extensions: 1210 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1188 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1210 length of database: 80,573,946 effective HSP length: 84 effective length of database: 62,147,622 effective search space used: 1491542928 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)