| Clone Name | rbaet30a07 |
|---|---|
| Clone Library Name | barley_pub |
>PALY_RHOTO (P11544) Phenylalanine ammonia-lyase (EC 4.3.1.5)| Length = 716 Score = 28.5 bits (62), Expect = 4.0 Identities = 13/25 (52%), Positives = 18/25 (72%) Frame = -1 Query: 188 ASASPGSPATSFLSHRTTFLHAFAQ 114 ++AS SPA S+LS RT L+AF + Sbjct: 646 SAASTSSPALSYLSPRTQILYAFVR 670
>CD8B_FELCA (P79336) T-cell surface glycoprotein CD8 beta chain precursor (CD8b| antigen) Length = 210 Score = 27.7 bits (60), Expect = 6.8 Identities = 18/61 (29%), Positives = 26/61 (42%) Frame = +2 Query: 146 GKGN*LQDSRAKPTRELATSKTIRRFCCCRLATTLTTELTFCGASAMARHASGVALLWIS 325 GKG L PT T K R CR + +T + CG + +GV +L +S Sbjct: 127 GKGTRLSVVDVLPTNSQPTKKPTPRKKMCRPPSPVTQKGPSCGLLTLGLLVAGVLVLLVS 186 Query: 326 V 328 + Sbjct: 187 L 187
>HXD13_CHICK (P24344) Homeobox protein Hox-D13 (Chox-4.8) (Chox-4G)| Length = 301 Score = 27.7 bits (60), Expect = 6.8 Identities = 18/42 (42%), Positives = 22/42 (52%) Frame = +2 Query: 275 ASAMARHASGVALLWISVFSMGSARSTPPSMWIVTAGAPPAA 400 A+A A ASG A S +AR PP+ +GAPPAA Sbjct: 39 AAAAAAAASGFAYAGGGERSGAAARPDPPAKDCPGSGAPPAA 80
>FUT3_BOVIN (Q11126) Galactoside 3(4)-L-fucosyltransferase (EC 2.4.1.65) (Blood| group Lewis alpha-4-fucosyltransferase) (Lewis FT) (Fucosyltransferase 3) (FUCT-III) (FUTB) Length = 365 Score = 27.3 bits (59), Expect = 8.9 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = +2 Query: 305 VALLWISVFSMGSARSTPPSMWIVTAGAPPAAT 403 +AL + S M + P MW+ GAP AT Sbjct: 26 LALCFFSYLRMSQEKPKPKPMWVSELGAPSQAT 58
>6PGL_BLOFL (Q7VR81) 6-phosphogluconolactonase (EC 3.1.1.31)| (6-P-gluconolactonase) Length = 338 Score = 27.3 bits (59), Expect = 8.9 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 278 SAMARHASGVALLWISVFS 334 S ++RHASG+ +WIS+ S Sbjct: 315 SVISRHASGMGPMWISILS 333 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,401,390 Number of Sequences: 219361 Number of extensions: 600699 Number of successful extensions: 1793 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1775 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1793 length of database: 80,573,946 effective HSP length: 111 effective length of database: 56,224,875 effective search space used: 1349397000 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)