| Clone Name | rbaet30a04 |
|---|---|
| Clone Library Name | barley_pub |
>MYCT_RAT (Q921A2) Proton myo-inositol cotransporter (H(+)-myo-inositol| cotransporter) (Hmit) Length = 618 Score = 37.0 bits (84), Expect = 0.011 Identities = 20/45 (44%), Positives = 27/45 (60%), Gaps = 6/45 (13%) Frame = -3 Query: 394 YASIAAAGWVFMFCFLPETRGEGLEDTEKLFG------GTGDAVE 278 YA AA G +F++ LPET+G+ LE+ E LF GT D+ E Sbjct: 549 YAGFAAVGLLFVYGCLPETKGKKLEEIESLFDHRLCTCGTADSDE 593
>MYCT_HUMAN (Q96QE2) Proton myo-inositol cotransporter (H(+)-myo-inositol| cotransporter) (Hmit) Length = 629 Score = 37.0 bits (84), Expect = 0.011 Identities = 20/45 (44%), Positives = 27/45 (60%), Gaps = 6/45 (13%) Frame = -3 Query: 394 YASIAAAGWVFMFCFLPETRGEGLEDTEKLFG------GTGDAVE 278 YA AA G +F++ LPET+G+ LE+ E LF GT D+ E Sbjct: 560 YAGFAAVGLLFIYGCLPETKGKKLEEIESLFDNRLCTCGTSDSDE 604
>QUTD_EMENI (P15325) Quinate permease (Quinate transporter)| Length = 533 Score = 30.4 bits (67), Expect = 1.1 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = -3 Query: 394 YASIAAAGWVFMFCFLPETRGEGLEDTEKLF 302 +AS+ VF+F +PET+G LE E LF Sbjct: 460 FASLMILSIVFVFFLIPETKGVPLESMETLF 490
>GTR6_HUMAN (Q9UGQ3) Solute carrier family 2, facilitated glucose transporter| member 6 (Glucose transporter type 6) (Glucose transporter type 9) Length = 507 Score = 30.4 bits (67), Expect = 1.1 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -3 Query: 394 YASIAAAGWVFMFCFLPETRGEGLEDTEKLF 302 +A+I VF C +PET+G LE E F Sbjct: 468 FAAICLVSLVFTGCCVPETKGRSLEQIESFF 498
>UL79_HCMVA (P16752) Protein UL79| Length = 295 Score = 30.4 bits (67), Expect = 1.1 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +1 Query: 244 AWTWHAHAHLPSPRHRQYHRRASPCPPDLRPSS 342 A T H H P P+ +Q+H P PP P+S Sbjct: 240 AGTLSRHPHRPHPQQQQHHHPGPPHPPLSHPAS 272
>ZAN_MOUSE (O88799) Zonadhesin precursor| Length = 5376 Score = 30.0 bits (66), Expect = 1.4 Identities = 15/44 (34%), Positives = 19/44 (43%) Frame = +1 Query: 190 RPLTVYHIQC*LTTE*STAWTWHAHAHLPSPRHRQYHRRASPCP 321 R L+ Y I C T W H H + P + Y R +PCP Sbjct: 5121 RVLSGYAIICQEAGANMTGWRDHTHCAMTCPANTVYQRCMTPCP 5164
>GTR3_SHEEP (P47843) Solute carrier family 2, facilitated glucose transporter| member 3 (Glucose transporter type 3, brain) Length = 494 Score = 30.0 bits (66), Expect = 1.4 Identities = 16/35 (45%), Positives = 19/35 (54%), Gaps = 3/35 (8%) Frame = -3 Query: 370 WVFMFCFLPETRGEGLEDTEKLFGG---TGDAVEK 275 WVF F +PETRG E+ + F G TG EK Sbjct: 443 WVFTFFKVPETRGRTFEEITRAFEGQVQTGTRGEK 477
>GTR3_BOVIN (P58352) Solute carrier family 2, facilitated glucose transporter| member 3 (Glucose transporter type 3, brain) Length = 494 Score = 30.0 bits (66), Expect = 1.4 Identities = 16/35 (45%), Positives = 19/35 (54%), Gaps = 3/35 (8%) Frame = -3 Query: 370 WVFMFCFLPETRGEGLEDTEKLFGG---TGDAVEK 275 WVF F +PETRG E+ + F G TG EK Sbjct: 443 WVFTFFKVPETRGRTFEEITRAFEGQTQTGTRGEK 477
>ENGA_SYNPX (Q7U8G2) GTP-binding protein engA| Length = 455 Score = 30.0 bits (66), Expect = 1.4 Identities = 17/41 (41%), Positives = 22/41 (53%) Frame = +2 Query: 248 GLGMPMLIFLLHGIASTTEELLRVLQTFAPRLRQEAEHEHP 370 GLG P I +HG+ T +LL + TF P QE + E P Sbjct: 139 GLGEPHPISAIHGVG--TGDLLDQVLTFLPPKDQEGDEEEP 177
>FOXGA_HUMAN (P55316) Forkhead box protein G1A (Forkhead-related protein FKHL2)| (Transcription factor BF-2) (Brain factor 2) (BF2) (HFK2) Length = 469 Score = 29.3 bits (64), Expect = 2.4 Identities = 14/47 (29%), Positives = 20/47 (42%) Frame = +1 Query: 256 HAHAHLPSPRHRQYHRRASPCPPDLRPSSPAGSRT*TPTRRQLCWRR 396 H ++H P H +H P PP +P P + P R+ RR Sbjct: 39 HHNSHHPQHHHHHHHHHHHPPPPAPQPPPPPQQQQPPPPPRRGARRR 85
>GTR3_RABIT (Q9XSC2) Solute carrier family 2, facilitated glucose transporter| member 3 (Glucose transporter type 3, brain) (Fragment) Length = 400 Score = 28.9 bits (63), Expect = 3.1 Identities = 14/40 (35%), Positives = 19/40 (47%) Frame = -3 Query: 394 YASIAAAGWVFMFCFLPETRGEGLEDTEKLFGGTGDAVEK 275 +A A ++F F +PETRG ED + F G K Sbjct: 340 FAVFLVAFFIFTFFKVPETRGRTFEDITRAFEGQAAEANK 379
>XYLE_ECOLI (P0AGF4) D-xylose-proton symporter (D-xylose transporter)| Length = 491 Score = 28.9 bits (63), Expect = 3.1 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = -3 Query: 394 YASIAAAGWVFMFCFLPETRGEGLEDTEKLF 302 Y + +FM+ F+PET+G+ LE+ E L+ Sbjct: 448 YGCMGVLAALFMWKFVPETKGKTLEELEALW 478
>XYLE_ECO57 (P0AGF5) D-xylose-proton symporter (D-xylose transporter)| Length = 491 Score = 28.9 bits (63), Expect = 3.1 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = -3 Query: 394 YASIAAAGWVFMFCFLPETRGEGLEDTEKLF 302 Y + +FM+ F+PET+G+ LE+ E L+ Sbjct: 448 YGCMGVLAALFMWKFVPETKGKTLEELEALW 478
>QAY_NEUCR (P11636) Quinate permease (Quinate transporter)| Length = 537 Score = 28.9 bits (63), Expect = 3.1 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = -3 Query: 394 YASIAAAGWVFMFCFLPETRGEGLEDTEKLF 302 +AS+ VF++ FLPET+ LE ++LF Sbjct: 464 FASLMLLSIVFIYFFLPETKSIPLEAMDRLF 494
>ZAN_PIG (Q28983) Zonadhesin precursor| Length = 2476 Score = 28.5 bits (62), Expect = 4.0 Identities = 14/42 (33%), Positives = 18/42 (42%) Frame = +1 Query: 196 LTVYHIQC*LTTE*STAWTWHAHAHLPSPRHRQYHRRASPCP 321 L+ Y I C + W H H LP P + Y +PCP Sbjct: 2230 LSGYAIICQESGPTLAGWRDHTHCALPCPANTVYQSCMTPCP 2271
>ISPD_SYNY3 (P74323) 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase| (EC 2.7.7.60) (4-diphosphocytidyl-2C-methyl-D-erythritol synthase) (MEP cytidylyltransferase) (MCT) Length = 230 Score = 28.5 bits (62), Expect = 4.0 Identities = 18/61 (29%), Positives = 29/61 (47%), Gaps = 1/61 (1%) Frame = -2 Query: 365 VHVLLPAGDEGRRSG-GHGEALRWYWRCRGEGR*AWACQVHAVDYSVVSQHCMWYTVSGR 189 +H+L+PA G+R G GH + L G+ +W Q ++ SQ W + G+ Sbjct: 1 MHLLIPAAGSGKRMGSGHNKLL---LNVLGQPLLSWTVQA-----ALASQSIEWIGIMGQ 52 Query: 188 P 186 P Sbjct: 53 P 53
>CWC25_CRYNE (Q5KIP8) Pre-mRNA-splicing factor CWC25| Length = 434 Score = 28.5 bits (62), Expect = 4.0 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 271 LPSPRHRQYHRRASPCPPDLRPSSPAGS 354 +P PRH Y+ PD+RPSSP S Sbjct: 318 IPPPRHLSYNHST----PDVRPSSPPSS 341
>HXT16_YEAST (P47185) Hexose transporter HXT16| Length = 567 Score = 28.5 bits (62), Expect = 4.0 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = -3 Query: 394 YASIAAAGWVFMFCFLPETRGEGLEDTEKLF 302 + A ++++F FLPET G LE+T+ L+ Sbjct: 494 FVGCLVAMFLYVFFFLPETIGLSLEETQLLY 524
>GTR10_HUMAN (O95528) Solute carrier family 2, facilitated glucose transporter| member 10 (Glucose transporter type 10) Length = 541 Score = 28.5 bits (62), Expect = 4.0 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = -3 Query: 394 YASIAAAGWVFMFCFLPETRGEGLEDTEKLF 302 Y A G F++ F+PET+G+ L + ++ F Sbjct: 482 YGLTAVLGLGFIYLFVPETKGQSLAEIDQQF 512
>GASR_BOVIN (P79266) Gastrin/cholecystokinin type B receptor (CCK-B receptor)| (CCK-BR) (Cholecystokinin-2 receptor) (CCK2-R) Length = 454 Score = 28.5 bits (62), Expect = 4.0 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = -1 Query: 357 SASCRRRGAKVWRTRRSSSVVLAMPWRRKMSMGMPSP 247 SA CR A+VW+TR ++ V+ W + +P P Sbjct: 154 SAICRPLQARVWQTRSHAARVIVATWMLSGLLMVPYP 190
>GASR_CANFA (P30552) Gastrin/cholecystokinin type B receptor (CCK-B receptor)| (CCK-BR) (Cholecystokinin-2 receptor) (CCK2-R) Length = 453 Score = 28.1 bits (61), Expect = 5.3 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = -1 Query: 357 SASCRRRGAKVWRTRRSSSVVLAMPWRRKMSMGMPSP 247 SA CR A+VW+TR ++ V+ W + +P P Sbjct: 154 SAICRPLQARVWQTRSHAARVIIATWMLSGLLMVPYP 190
>GASR_HUMAN (P32239) Gastrin/cholecystokinin type B receptor (CCK-B receptor)| (CCK-BR) (Cholecystokinin-2 receptor) (CCK2-R) Length = 447 Score = 28.1 bits (61), Expect = 5.3 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = -1 Query: 357 SASCRRRGAKVWRTRRSSSVVLAMPWRRKMSMGMPSP 247 SA CR A+VW+TR ++ V+ W + +P P Sbjct: 154 SAICRPLQARVWQTRSHAARVIVATWLLSGLLMVPYP 190
>FOXGB_HUMAN (P55315) Forkhead box protein G1B (Forkhead-related protein FKHL1)| (Transcription factor BF-1) (Brain factor 1) (BF1) (HFK1) Length = 477 Score = 28.1 bits (61), Expect = 5.3 Identities = 11/38 (28%), Positives = 17/38 (44%) Frame = +1 Query: 256 HAHAHLPSPRHRQYHRRASPCPPDLRPSSPAGSRT*TP 369 H ++H P H +H P PP +P P ++ P Sbjct: 39 HHNSHHPQHHHHHHHHHHHPPPPAPQPPPPRAAQQQQP 76
>VGLB_EHV1 (P18050) Glycoprotein B precursor (Glycoprotein 14)| Length = 980 Score = 28.1 bits (61), Expect = 5.3 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = -1 Query: 360 CSASCRRRGAKVWRTRR-SSSVVLAMPWRRKMS 265 C S + RGA+ W+T ++S V MPWR S Sbjct: 259 CRPSLQLRGARAWQTTNDTTSYVGWMPWRHYTS 291
>FOXL2_MOUSE (O88470) Forkhead box protein L2 (Pituitary forkhead factor)| (P-Frk) Length = 375 Score = 28.1 bits (61), Expect = 5.3 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +1 Query: 256 HAHAHLPSPRHRQYHRRASPCPPDLRPSSPA 348 H HA P +H A+P P L P+SPA Sbjct: 297 HLHAAAAPPPAPPHHGAAAPPPGQLSPASPA 327
>HMX_STRPU (Q26656) Homeobox protein Hmx (SpHmx) (H6-like) (Fragment)| Length = 405 Score = 28.1 bits (61), Expect = 5.3 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +1 Query: 274 PSPRHRQYHRRASPCPPDLRPSSPAGSRT*TPTR 375 PSPRH R SP P P+ P S P R Sbjct: 15 PSPRHETSKMRLSPDRPSHHPARPPASLASQPLR 48
>FOXL2_HUMAN (P58012) Forkhead box protein L2| Length = 376 Score = 28.1 bits (61), Expect = 5.3 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +1 Query: 256 HAHAHLPSPRHRQYHRRASPCPPDLRPSSPA 348 H HA P +H A+P P L P+SPA Sbjct: 298 HLHAAAAPPPAPPHHGAAAPPPGQLSPASPA 328
>GTR14_HUMAN (Q8TDB8) Solute carrier family 2, facilitated glucose transporter| member 14 (Glucose transporter type 14) Length = 520 Score = 27.7 bits (60), Expect = 6.9 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = -3 Query: 364 FMFCFLPETRGEGLEDTEKLFGGTGDAVEKEDEHG 260 F F +PETRG ED + F G ++ + G Sbjct: 469 FTFFKVPETRGRTFEDITRAFEGQAHGADRSGKDG 503
>GASR_MOUSE (P56481) Gastrin/cholecystokinin type B receptor (CCK-B receptor)| (CCK-BR) (Cholecystokinin-2 receptor) (CCK2-R) Length = 453 Score = 27.7 bits (60), Expect = 6.9 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = -1 Query: 357 SASCRRRGAKVWRTRRSSSVVLAMPWRRKMSMGMPSP 247 SA CR A+VW+TR ++ V+ W + +P P Sbjct: 154 SAICRPLQARVWQTRSHAARVILATWLLSGLLMVPYP 190
>GTR3_CANFA (P47842) Solute carrier family 2, facilitated glucose transporter| member 3 (Glucose transporter type 3, brain) Length = 495 Score = 27.7 bits (60), Expect = 6.9 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -3 Query: 367 VFMFCFLPETRGEGLEDTEKLFGGTGDAVEKEDE 266 VF F +PETRG E+ + F G G + ++ Sbjct: 444 VFTFFKVPETRGRTFEEITRAFEGQGQDANRAEK 477
>GASR_RAT (P30553) Gastrin/cholecystokinin type B receptor (CCK-B receptor)| (CCK-BR) (Cholecystokinin-2 receptor) (CCK2-R) Length = 452 Score = 27.7 bits (60), Expect = 6.9 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = -1 Query: 357 SASCRRRGAKVWRTRRSSSVVLAMPWRRKMSMGMPSP 247 SA CR A+VW+TR ++ V+ W + +P P Sbjct: 154 SAICRPLQARVWQTRSHAARVILATWLLSGLLMVPYP 190
>GASR_RABIT (P46627) Gastrin/cholecystokinin type B receptor (CCK-B receptor)| (CCK-BR) (Cholecystokinin-2 receptor) (CCK2-R) Length = 452 Score = 27.7 bits (60), Expect = 6.9 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = -1 Query: 357 SASCRRRGAKVWRTRRSSSVVLAMPWRRKMSMGMPSP 247 SA CR A+VW+TR ++ V+ W + +P P Sbjct: 152 SAICRPLQARVWQTRSHAARVILATWLLSGLLMVPYP 188
>GASR_PRANA (P30796) Gastrin/cholecystokinin type B receptor (CCK-B receptor)| (CCK-BR) (Cholecystokinin-2 receptor) (CCK2-R) Length = 450 Score = 27.7 bits (60), Expect = 6.9 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = -1 Query: 357 SASCRRRGAKVWRTRRSSSVVLAMPWRRKMSMGMPSP 247 SA CR A+VW+TR ++ V+ W + +P P Sbjct: 154 SAICRPLQARVWQTRSHAARVILATWLLSGLLMVPYP 190
>GTR3_PONPY (Q5R608) Solute carrier family 2, facilitated glucose transporter| member 3 (Glucose transporter type 3, brain) Length = 496 Score = 27.7 bits (60), Expect = 6.9 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = -3 Query: 364 FMFCFLPETRGEGLEDTEKLFGGTGDAVEKEDEHG 260 F F +PETRG ED + F G ++ + G Sbjct: 445 FTFFKVPETRGRTFEDITRAFEGQAHGADRSGKDG 479
>GTR3_HUMAN (P11169) Solute carrier family 2, facilitated glucose transporter| member 3 (Glucose transporter type 3, brain) Length = 496 Score = 27.7 bits (60), Expect = 6.9 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = -3 Query: 364 FMFCFLPETRGEGLEDTEKLFGGTGDAVEKEDEHG 260 F F +PETRG ED + F G ++ + G Sbjct: 445 FTFFKVPETRGRTFEDITRAFEGQAHGADRSGKDG 479
>ASH1_YEAST (P34233) Daughter cells HO repressor protein ASH1| Length = 588 Score = 27.7 bits (60), Expect = 6.9 Identities = 16/38 (42%), Positives = 18/38 (47%) Frame = +1 Query: 265 AHLPSPRHRQYHRRASPCPPDLRPSSPAGSRT*TPTRR 378 A+ PSPR YHR A PP S S T +RR Sbjct: 448 AYTPSPRSPNYHRFALDSPPQSPRRSSNSSITKKGSRR 485
>UCRH_RAT (Q5M9I5) Ubiquinol-cytochrome c reductase complex 11 kDa protein,| mitochondrial precursor (EC 1.10.2.2) (Mitochondrial hinge protein) (Cytochrome C1, nonheme 11 kDa protein) (Complex III subunit VIII) Length = 89 Score = 27.3 bits (59), Expect = 9.0 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -3 Query: 328 GLEDTEKLFGGTGDAVEKEDE 266 GLED K+ G+GD E+E+E Sbjct: 2 GLEDERKMLTGSGDPKEEEEE 22
>UCRH_MOUSE (P99028) Ubiquinol-cytochrome c reductase complex 11 kDa protein,| mitochondrial precursor (EC 1.10.2.2) (Mitochondrial hinge protein) (Cytochrome C1, nonheme 11 kDa protein) (Complex III subunit VIII) Length = 89 Score = 27.3 bits (59), Expect = 9.0 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -3 Query: 328 GLEDTEKLFGGTGDAVEKEDE 266 GLED K+ G+GD E+E+E Sbjct: 2 GLEDERKMLTGSGDPKEEEEE 22
>SRRM1_CHICK (Q5ZMJ9) Serine/arginine repetitive matrix protein 1| Length = 888 Score = 27.3 bits (59), Expect = 9.0 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = +1 Query: 256 HAHAHLPSPRHRQYHRRASPCPPDLRPSSPAGSRT*TPT 372 H+H+ PSP R+ + SP PS P R +P+ Sbjct: 518 HSHSRSPSPSPRKRQKEPSPRRRRRSPSPPPARRRRSPS 556 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,846,127 Number of Sequences: 219361 Number of extensions: 1221667 Number of successful extensions: 4114 Number of sequences better than 10.0: 39 Number of HSP's better than 10.0 without gapping: 3877 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4105 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 1370455656 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)