| Clone Name | rbaet29g04 |
|---|---|
| Clone Library Name | barley_pub |
>TCPG_OXYGR (O00782) T-complex protein 1 subunit gamma (TCP-1-gamma)| (CCT-gamma) (Chaperonin subunit CCTV gamma) Length = 559 Score = 28.9 bits (63), Expect = 3.3 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +1 Query: 76 ENGGSSTNILLRCGHILSKVQKLHEIDQHPSI 171 E G +T++++ G ILS V+ E D HP++ Sbjct: 90 EVGDGTTSVIILAGEILSAVESFLERDIHPTV 121
>CYO8_VIOOD (P58440) Cycloviolacin-O8| Length = 30 Score = 28.9 bits (63), Expect = 3.3 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -3 Query: 270 PCESCVHVSCARIKMVWTCRSSLC 199 PCESCV + C + +C+S +C Sbjct: 4 PCESCVWIPCISSVVGCSCKSKVC 27
>MURB_BACSU (P18579) UDP-N-acetylenolpyruvoylglucosamine reductase (EC| 1.1.1.158) (UDP-N-acetylmuramate dehydrogenase) Length = 303 Score = 28.5 bits (62), Expect = 4.3 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = +1 Query: 67 VVYENGGSSTNILLRCGHILSKVQKLHEIDQHPSIEIDKG 186 +V G S+ ++L H+ +++ +EID H +EI G Sbjct: 262 IVNAGGASAKDVLDLIDHVKKTIREKYEIDMHTEVEIIGG 301
>FSHP1_RAT (Q63517) Follicle-stimulating hormone primary response protein (FSH| primary response protein 1) (Leucine-rich primary response protein 1) Length = 745 Score = 28.1 bits (61), Expect = 5.6 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = -1 Query: 140 FCTFDNICPHLNKILVLLPPFSYTTSLYFSCQALTC 33 F +F I P L L L P +T+S+YF C L C Sbjct: 458 FSSFSEIKPLL---LDHLAPLFFTSSIYFKCSLLQC 490
>SUHW1_HUMAN (P59817) Suppressor of hairy wing homolog 1 (3'OY11.1)| Length = 542 Score = 28.1 bits (61), Expect = 5.6 Identities = 19/67 (28%), Positives = 30/67 (44%) Frame = +1 Query: 106 LRCGHILSKVQKLHEIDQHPSIEIDKGVTNYAEAGSTRPHHFYSCTRYMNTRFARSCSTD 285 L C +L ++ ++ + H +E +K + E +T H C R T F C D Sbjct: 301 LSCVKVLKNIKFMNHMKHH--LEFEKQRNDSWEDHTTCQH----CHRQFPTPFQLQCHID 354 Query: 286 VVPVAMG 306 V +AMG Sbjct: 355 SVHIAMG 361
>LIC4_ASHGO (Q751A7) Protein ATC1/LIC4| Length = 304 Score = 28.1 bits (61), Expect = 5.6 Identities = 15/56 (26%), Positives = 27/56 (48%), Gaps = 1/56 (1%) Frame = +1 Query: 154 DQHPSIEIDKGVTNYAEAGSTR-PHHFYSCTRYMNTRFARSCSTDVVPVAMGGARS 318 ++ P +++ +G + R PH S + + ++ S D+ P A GGARS Sbjct: 46 NEEPFVQVHEGALGSVDMDGQRYPHGRNSLSSIVGSKAIIQQSMDIHPTAQGGARS 101
>Y3150_VIBF1 (Q5E176) UPF0082 protein VFA0150| Length = 240 Score = 28.1 bits (61), Expect = 5.6 Identities = 19/67 (28%), Positives = 33/67 (49%) Frame = +1 Query: 28 KLQVKA*HEK*SDVVYENGGSSTNILLRCGHILSKVQKLHEIDQHPSIEIDKGVTNYAEA 207 K++V + + K + +NGG+ ++ L H++SK +K DQ P+ IDK + Sbjct: 19 KIKVYSKYGKEIYMCAKNGGADPDMNLSLKHLISKAKK----DQVPAHVIDKALDKATGG 74 Query: 208 GSTRPHH 228 G H Sbjct: 75 GGEDYQH 81
>CHFR_MOUSE (Q810L3) Ubiquitin-protein ligase CHFR (EC 6.3.2.-) (Checkpoint| with forkhead and RING finger domains protein) Length = 664 Score = 27.7 bits (60), Expect = 7.4 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -3 Query: 264 ESCVHVSCARIKMVWTCRSSLCVIC 190 + C+H CA W RSSLC C Sbjct: 317 QPCMHTFCAACYSGWMERSSLCPTC 341
>CHFR_HUMAN (Q96EP1) Ubiquitin-protein ligase CHFR (EC 6.3.2.-) (Checkpoint| with forkhead and RING finger domains protein) Length = 664 Score = 27.7 bits (60), Expect = 7.4 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -3 Query: 264 ESCVHVSCARIKMVWTCRSSLCVIC 190 + C+H CA W RSSLC C Sbjct: 318 QPCMHTFCAACYSGWMERSSLCPTC 342 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,712,905 Number of Sequences: 219361 Number of extensions: 911685 Number of successful extensions: 2457 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 2409 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2457 length of database: 80,573,946 effective HSP length: 89 effective length of database: 61,050,817 effective search space used: 1465219608 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)