| Clone Name | rbaet27h10 |
|---|---|
| Clone Library Name | barley_pub |
>RL4_METAC (Q8TRU6) 50S ribosomal protein L4P| Length = 253 Score = 31.2 bits (69), Expect = 0.70 Identities = 15/42 (35%), Positives = 24/42 (57%) Frame = +1 Query: 103 ARQPHAQGKQTAFTCTPNAYKNTKSKYRRRRHGVPTACAVTS 228 AR PHA+G + A P A ++ K + RR+ + +A A T+ Sbjct: 81 ARVPHAKGGRRAHPPKPEADRSEKVNTKERRYAIRSAIAATT 122
>RL4_METMA (Q8PV49) 50S ribosomal protein L4P| Length = 253 Score = 30.8 bits (68), Expect = 0.92 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = +1 Query: 103 ARQPHAQGKQTAFTCTPNAYKNTKSKYRRRRHGVPTACAVT 225 AR PHA+G + A P A ++ K + RR+ + +A A T Sbjct: 81 ARVPHAKGGRRAHPPKPEADRSEKVNTKERRYAIRSAIAAT 121
>E75BB_DROME (P13055) Ecdysone-induced protein 75B isoform B (E75-C)| Length = 1412 Score = 29.3 bits (64), Expect = 2.7 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +2 Query: 56 HKTVVASQHVQEPRSRPDSHTHKVNKQHSRAHQTH 160 H V+AS H Q+ + + + H+ Q + HQ H Sbjct: 313 HVNVIASNHFQQQQQQHQAQQHQQQHQQHQQHQQH 347
>MOT3_YEAST (P54785) Transcriptional activator/repressor MOT3 (Modulator of| transcription protein 3) (Hypoxic gene repressor protein 7) Length = 490 Score = 28.9 bits (63), Expect = 3.5 Identities = 15/51 (29%), Positives = 28/51 (54%), Gaps = 5/51 (9%) Frame = +2 Query: 71 ASQHVQEPRSRPDSHTHKVNK----QHSRAHQTHTRIQR-ANTDDVGTASL 208 A H+Q+ + + H + ++ QH Q HT +Q +NT+++G+ SL Sbjct: 3 ADHHLQQQQQQRQQHQQQQHQQQQHQHQHQQQQHTILQNVSNTNNIGSDSL 53
>SPEN_DROME (Q8SX83) Protein split ends| Length = 5560 Score = 28.1 bits (61), Expect = 6.0 Identities = 14/47 (29%), Positives = 26/47 (55%) Frame = +2 Query: 23 KKIQSKLNYYYHKTVVASQHVQEPRSRPDSHTHKVNKQHSRAHQTHT 163 K+ + + ++ H +S+H +S+ D H H+ K+HS A T+T Sbjct: 2287 KREKEREHFSSHANSSSSRH----KSKRDHHHHREKKRHSVAESTNT 2329
>GLAS_DROVI (Q24732) Protein glass| Length = 598 Score = 28.1 bits (61), Expect = 6.0 Identities = 13/47 (27%), Positives = 26/47 (55%), Gaps = 2/47 (4%) Frame = +2 Query: 5 SYN*TLKKIQSKLNY--YYHKTVVASQHVQEPRSRPDSHTHKVNKQH 139 SYN Q+ L+Y + H+ +++ Q+ +S+ +H H++ QH Sbjct: 170 SYNFASNPHQASLSYTVHPHQMLISPNGSQQQQSQSSTHPHQLQSQH 216
>INSR_DROME (P09208) Insulin-like receptor precursor (EC 2.7.10.1) (DIR) (DInr)| (dIRH) [Contains: Insulin-like receptor alpha subunit; Insulin-like receptor beta 1 subunit; Insulin-like receptor beta 2 subunit] Length = 2144 Score = 27.7 bits (60), Expect = 7.8 Identities = 14/49 (28%), Positives = 20/49 (40%) Frame = +2 Query: 95 RSRPDSHTHKVNKQHSRAHQTHTRIQRANTDDVGTASLLHALSPHSCRV 241 R H H H + HQ H + Q+AN LL L+ + R+ Sbjct: 175 RQHQQQHHHHYQHHHQQHHQQHHQRQQANVSYTKFLLLLQTLAAATTRL 223
>UPL2_ARATH (Q8H0T4) E3 ubiquitin protein ligase UPL2 (EC 6.3.2.-)| (Ubiquitin-protein ligase 2) Length = 3658 Score = 27.7 bits (60), Expect = 7.8 Identities = 20/57 (35%), Positives = 25/57 (43%) Frame = +1 Query: 70 SITTRTRAEI*ARQPHAQGKQTAFTCTPNAYKNTKSKYRRRRHGVPTACAVTSLMQS 240 S+ T TRA A Q ++ PN KNT S R HG T+ V L Q+ Sbjct: 1993 SLETLTRAANAAEQLKSE--------VPNEQKNTDSDERHDSHGTSTSTEVDELNQN 2041
>ADAM8_MOUSE (Q05910) ADAM 8 precursor (EC 3.4.24.-) (A disintegrin and| metalloproteinase domain 8) (Cell surface antigen MS2) (Macrophage cysteine-rich glycoprotein) (CD156 antigen) Length = 826 Score = 27.7 bits (60), Expect = 7.8 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = -3 Query: 150 CARECCLFTLCVWLSGLDLGSCTCC 76 C CC T C + G + S TCC Sbjct: 425 CQNPCCNATTCQLVKGAECASGTCC 449 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,294,832 Number of Sequences: 219361 Number of extensions: 646263 Number of successful extensions: 1950 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1904 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1944 length of database: 80,573,946 effective HSP length: 73 effective length of database: 64,560,593 effective search space used: 1549454232 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)