| Clone Name | rbaet27a08 |
|---|---|
| Clone Library Name | barley_pub |
>PURK_BRUME (P52559) Phosphoribosylaminoimidazole carboxylase ATPase subunit| (EC 4.1.1.21) (AIR carboxylase) (AIRC) Length = 362 Score = 28.9 bits (63), Expect = 3.6 Identities = 15/50 (30%), Positives = 23/50 (46%) Frame = +1 Query: 127 TCTPNKYKSKYRRRGHVIPTACAGTSLMQSGVRHIAGVVWGNSPHRRRCV 276 T N++ + GH ACA S + +R +AG+ GN+ CV Sbjct: 266 TLLANEFAPRVHNSGHWTEAACA-ISQFEQHIRAVAGLPLGNTDRHSDCV 314
>SYI_PYRAE (Q8ZWU4) Isoleucyl-tRNA synthetase (EC 6.1.1.5) (Isoleucine--tRNA| ligase) (IleRS) Length = 981 Score = 28.5 bits (62), Expect = 4.6 Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 3/41 (7%) Frame = +3 Query: 69 YKG---LDLDPTATRTRKTKSNHVYTKQIQEQIPTTWACHS 182 YKG D+D TR ++K V+ ++I+ + P W C S Sbjct: 367 YKGKHVYDVDKEVTRDLRSKGLLVFEEKIRHEYPHCWRCGS 407
>VP13B_MOUSE (Q80TY5) Vacuolar protein sorting 13B (Cohen syndrome protein 1| homolog) (Fragment) Length = 1603 Score = 28.1 bits (61), Expect = 6.1 Identities = 12/33 (36%), Positives = 15/33 (45%) Frame = +3 Query: 162 TTWACHSHCMRWYLTHAEWRTSHSWSSVGQLSP 260 T W S CM + H E+R H +G SP Sbjct: 55 TPWFVPSLCMSFQFAHLEFRLCHHLDQLGTASP 87
>SUR2_CAEEL (Q10669) Protein sur-2| Length = 1587 Score = 27.7 bits (60), Expect = 7.9 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +3 Query: 57 QHNTYKGLDLDPTATRTRKTKSNHVYTKQIQEQIP 161 QH+T +D + +T + +SNH +Q+Q QIP Sbjct: 1453 QHHTSTHQMMDTSQHQTIQQQSNHPTQQQLQHQIP 1487
>GLTL1_MOUSE (Q9JJ61) Putative polypeptide| N-acetylgalactosaminyltransferase-like protein 1 (EC 2.4.1.41) (Protein-UDP acetylgalactosaminyltransferase-like protein 1) (UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase-like protein 1) (Polypeptide G Length = 558 Score = 27.7 bits (60), Expect = 7.9 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +1 Query: 127 TCTPNKYKSKYRRRGHVIPTACAGTSL 207 TC P + K K+RRRG I + +G L Sbjct: 505 TCNPKEGKQKWRRRGSFIQHSVSGLCL 531
>POLG_HRV89 (P07210) Genome polyprotein [Contains: Coat protein VP4 (P1A); Coat| protein VP2 (P1B); Coat protein VP3 (P1C); Coat protein VP1 (P1D); Picornain 2A (EC 3.4.22.29) (Core protein P2A); Core protein P2B; Core protein P2C; Core protein P3A; Genome Length = 2163 Score = 27.7 bits (60), Expect = 7.9 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +1 Query: 145 YKSKYRRRGHVIPTACAGTSLMQSGVRHI 231 YKSKY +P+ CAGTS+ + + +I Sbjct: 1977 YKSKYYEVEGGMPSGCAGTSIFNTIINNI 2005
>PALI_DEBHA (Q6BNJ2) pH-response regulator protein palI/RIM9| Length = 365 Score = 27.7 bits (60), Expect = 7.9 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -1 Query: 203 EVPAHAVGMTCPRRRYLLLYLFGVHVIAFCF 111 E P A R RY++ L VH++ FCF Sbjct: 83 EYPDFAAAELPSRARYVISKLLVVHIVGFCF 113
>RAII_RHIET (O54451) Autoinducer synthesis protein raiI| Length = 212 Score = 27.7 bits (60), Expect = 7.9 Identities = 11/36 (30%), Positives = 16/36 (44%) Frame = +3 Query: 84 LDPTATRTRKTKSNHVYTKQIQEQIPTTWACHSHCM 191 L T K++ H + + I PTTW C C+ Sbjct: 72 LPTTGATMLKSEFRHFFDQPIDVDSPTTWECTRFCL 107 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,940,429 Number of Sequences: 219361 Number of extensions: 852563 Number of successful extensions: 2018 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1962 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2018 length of database: 80,573,946 effective HSP length: 68 effective length of database: 65,657,398 effective search space used: 1575777552 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)