| Clone Name | rbaet26c05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CNTN4_RAT (Q62845) Contactin-4 precursor (Brain-derived immunogl... | 32 | 0.41 | 2 | CNTN4_MOUSE (Q69Z26) Contactin-4 precursor (Brain-derived immuno... | 32 | 0.41 | 3 | CNTN4_HUMAN (Q8IWV2) Contactin-4 precursor (Brain-derived immuno... | 31 | 0.91 | 4 | AT1A1_OREMO (Q9YH26) Sodium/potassium-transporting ATPase alpha-... | 28 | 5.9 |
|---|
>CNTN4_RAT (Q62845) Contactin-4 precursor (Brain-derived immunoglobulin| superfamily protein 2) (BIG-2) Length = 1026 Score = 32.0 bits (71), Expect = 0.41 Identities = 13/32 (40%), Positives = 20/32 (62%), Gaps = 3/32 (9%) Frame = +1 Query: 52 AAPNWVGMS*VLHIHMQKQIWWFCK---RPNP 138 A PNWV + +H+ M++ ++W CK RP P Sbjct: 314 AQPNWVQIINDIHVAMEESVFWECKANGRPKP 345
>CNTN4_MOUSE (Q69Z26) Contactin-4 precursor (Brain-derived immunoglobulin| superfamily protein 2) (BIG-2) Length = 1026 Score = 32.0 bits (71), Expect = 0.41 Identities = 13/32 (40%), Positives = 20/32 (62%), Gaps = 3/32 (9%) Frame = +1 Query: 52 AAPNWVGMS*VLHIHMQKQIWWFCK---RPNP 138 A PNWV + +H+ M++ ++W CK RP P Sbjct: 314 AQPNWVQIINDIHVAMEESVFWECKANGRPKP 345
>CNTN4_HUMAN (Q8IWV2) Contactin-4 precursor (Brain-derived immunoglobulin| superfamily protein 2) (BIG-2) Length = 1026 Score = 30.8 bits (68), Expect = 0.91 Identities = 12/32 (37%), Positives = 19/32 (59%), Gaps = 3/32 (9%) Frame = +1 Query: 52 AAPNWVGMS*VLHIHMQKQIWWFCK---RPNP 138 A PNW+ +H+ M++ ++W CK RP P Sbjct: 314 AQPNWIQKINDIHVAMEENVFWECKANGRPKP 345
>AT1A1_OREMO (Q9YH26) Sodium/potassium-transporting ATPase alpha-1 chain precursor| (EC 3.6.3.9) (Sodium pump 1) (Na+/K+ ATPase 1) Length = 1023 Score = 28.1 bits (61), Expect = 5.9 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +1 Query: 70 GMS*VLHIHMQKQIWWFCKRPNPIL 144 GM L ++ K +WWFC P +L Sbjct: 973 GMDVALRMYPMKPLWWFCAFPYSLL 997 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,889,056 Number of Sequences: 219361 Number of extensions: 807769 Number of successful extensions: 1779 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1754 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1779 length of database: 80,573,946 effective HSP length: 76 effective length of database: 63,902,510 effective search space used: 1533660240 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)