| Clone Name | rbaet25g07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | VG24_ICHV1 (Q00123) Hypothetical gene 24 protein | 28 | 5.1 | 2 | ITB4_HUMAN (P16144) Integrin beta-4 precursor (GP150) (CD104 ant... | 28 | 5.1 | 3 | YBP3_YEAST (P38227) Hypothetical transport protein YBR043C | 28 | 8.7 |
|---|
>VG24_ICHV1 (Q00123) Hypothetical gene 24 protein| Length = 333 Score = 28.5 bits (62), Expect = 5.1 Identities = 14/44 (31%), Positives = 26/44 (59%) Frame = +1 Query: 34 TVYISNIIVAEELDKANSRGEVEQINMHNASRVDENVELEDGVG 165 T IS + + ++ R EVE +N+ +++VD+N LE+ +G Sbjct: 14 TAAISRELTLAKRERDELRREVETLNLELSAQVDKNRALEETLG 57
>ITB4_HUMAN (P16144) Integrin beta-4 precursor (GP150) (CD104 antigen)| Length = 1822 Score = 28.5 bits (62), Expect = 5.1 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = -1 Query: 103 VPLLPYYLPCRAPLLQ*CWIYIPCKCCSS 17 +PLL LP A LL CW Y C CC + Sbjct: 715 IPLLLLLLPLLALLLLLCWKY--CACCKA 741
>YBP3_YEAST (P38227) Hypothetical transport protein YBR043C| Length = 689 Score = 27.7 bits (60), Expect = 8.7 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +1 Query: 31 CTVYISNIIVAEELDKANSRGEVEQINMHNASRVDEN 141 C V + +++ E L K +S+G + QI +VD N Sbjct: 274 CNVILLTVLLPETLRKQDSKGAIAQILAERRIQVDNN 310 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.312 0.135 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 25,335,655 Number of Sequences: 219361 Number of extensions: 382155 Number of successful extensions: 880 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 878 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 880 length of database: 80,573,946 effective HSP length: 40 effective length of database: 71,799,506 effective search space used: 1723188144 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits)