| Clone Name | rbaet25c11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | IKKB_DROME (Q9VEZ5) Inhibitor of nuclear factor kappa B kinase b... | 29 | 6.2 | 2 | HEM1_CHLMU (Q9PLR2) Glutamyl-tRNA reductase (EC 1.2.1.70) (GluTR) | 29 | 6.2 | 3 | NEDD1_MOUSE (P33215) Protein NEDD1 (Neural precursor cell expres... | 29 | 6.2 | 4 | ECX2_SULSO (Q9UXC0) Probable exosome complex exonuclease 2 (EC 3... | 28 | 8.1 |
|---|
>IKKB_DROME (Q9VEZ5) Inhibitor of nuclear factor kappa B kinase beta subunit| (EC 2.7.11.1) (DmIKK-beta) (Immune response deficient protein 5) (IKK-like protein) (Lipopolysaccharide-activated kinase) (DLAK) (Cactus kinase IKK) Length = 751 Score = 28.9 bits (63), Expect = 6.2 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = -2 Query: 429 PPLSLKAMEPIKRSSSCCKEPPISMLSRQFVAAKYK 322 PP+ L + K EP +S+LSR+F+A K+K Sbjct: 436 PPVMLYIFQVKKECDYKIPEPILSILSRKFIANKFK 471
>HEM1_CHLMU (Q9PLR2) Glutamyl-tRNA reductase (EC 1.2.1.70) (GluTR)| Length = 333 Score = 28.9 bits (63), Expect = 6.2 Identities = 14/52 (26%), Positives = 27/52 (51%), Gaps = 6/52 (11%) Frame = -2 Query: 444 SYCKEPPLSLKAMEPIKRSSSCCKEP------PISMLSRQFVAAKYKGMFSF 307 ++C PLSL++M+ + R C ++P S L F + ++G++ F Sbjct: 210 TFCSRQPLSLRSMDQVLREEVCFQDPYHVIFLGSSELRHAFPRSLWEGVWDF 261
>NEDD1_MOUSE (P33215) Protein NEDD1 (Neural precursor cell expressed| developmentally down-regulated protein 1) Length = 660 Score = 28.9 bits (63), Expect = 6.2 Identities = 22/84 (26%), Positives = 35/84 (41%) Frame = +2 Query: 125 KIVHTSTKEFSKPCPLMSNQKSTDQNTVQHEALLIITGSTHVNSVGGLRNIAQEASWF*L 304 KIV +S K KP PL+ + Q V + + S +N+ + ++ + L Sbjct: 58 KIVVSSCK--CKPVPLLELAEGQKQTCVDLNSTSMYLASGGLNNTVNIWDLKSKRLHRSL 115 Query: 305 KKENIPLYLAATNWRDSMLIGGSL 376 K + A NW D + GSL Sbjct: 116 KDHKCEVTCVAYNWNDCYIASGSL 139
>ECX2_SULSO (Q9UXC0) Probable exosome complex exonuclease 2 (EC 3.1.13.-)| Length = 275 Score = 28.5 bits (62), Expect = 8.1 Identities = 20/56 (35%), Positives = 28/56 (50%) Frame = -2 Query: 234 VIISKASCWTVF*SVDFWLDISGHGFENSLVDVCTILRLSSIFAHYSTKDDTVFAH 67 VI S WTV WLD+ + +++D CT L+S+ A Y+TK V H Sbjct: 130 VIEPGKSVWTV------WLDVYVLDYGGNVLDACT---LASVAALYNTKVYKVEQH 176 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,110,499 Number of Sequences: 219361 Number of extensions: 1160957 Number of successful extensions: 2937 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2855 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2937 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2735358828 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)