| Clone Name | rbaet24e11 |
|---|---|
| Clone Library Name | barley_pub |
>CRFR2_MOUSE (Q60748) Corticotropin-releasing factor receptor 2 precursor (CRF-R| 2) (CRF2) (Corticotropin-releasing hormone receptor 2) (CRH-R 2) (CRF-RB) (CRH-R2) Length = 431 Score = 28.9 bits (63), Expect = 3.3 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = -2 Query: 112 VGYCAHRVEITCALVVFLVSRSVRC 38 +G+C V + A ++FLV RS+RC Sbjct: 142 LGHCVSVVALVAAFLLFLVLRSIRC 166
>CRFR2_RAT (P47866) Corticotropin-releasing factor receptor 2 precursor (CRF-R| 2) (CRF2) (Corticotropin-releasing hormone receptor 2) (CRH-R 2) Length = 411 Score = 28.9 bits (63), Expect = 3.3 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = -2 Query: 112 VGYCAHRVEITCALVVFLVSRSVRC 38 +G+C V + A ++FLV RS+RC Sbjct: 122 LGHCVSVVALVAAFLLFLVLRSIRC 146
>CD209_PANTR (Q8HXZ7) CD209 antigen (Dendritic cell-specific ICAM-3-grabbing| nonintegrin 1) (DC-SIGN1) Length = 427 Score = 28.5 bits (62), Expect = 4.3 Identities = 16/48 (33%), Positives = 24/48 (50%) Frame = +3 Query: 120 YINLTRVTVSVGEVSTAE*GDIINQKIKQLKIRKYCICGRIQYDLPFF 263 Y LTR+ +VGE+ I Q++ QLK +C R ++ FF Sbjct: 239 YQELTRLKAAVGELPEKSKQQEIYQELTQLKAAVERLCRRCPWEWTFF 286
>ACMA_LACLC (Q48603) Probable N-acetylmuramidase precursor (EC 3.2.1.17)| (Peptidoglycan hydrolase) (Autolysin) (Lysosyme) Length = 437 Score = 27.7 bits (60), Expect = 7.3 Identities = 14/48 (29%), Positives = 27/48 (56%) Frame = +2 Query: 14 SIISAQ*CTANRPGHQENDKSTSNLNSMRTITDHSLHKLNTGNSFSWG 157 ++I +Q A+ P +T+N NS + ++ S+HK+ G++ WG Sbjct: 359 NLIVSQSAAASNPSTGSGSTATNNSNSTSSNSNASIHKVVKGDTL-WG 405
>SELI_MOUSE (Q80TA1) Selenoprotein I| Length = 398 Score = 27.3 bits (59), Expect = 9.5 Identities = 25/84 (29%), Positives = 36/84 (42%) Frame = -2 Query: 280 KKLSWKKKGRSYCILPHIQYFLIFNCLIFWLIISPYSAVETSPTETVTRVKFM**MVGYC 101 K + K K ++P L+F W++ SP +E P R+ + MVG Sbjct: 247 KSNTLKHKSVYEAMVPFFSPCLLFTLCTVWILWSPSDILEIHP-----RIFYF--MVGTA 299 Query: 100 AHRVEITCALVVFLVSRSVRCTLL 29 ITC L+V +S S RC L Sbjct: 300 F--ANITCQLIVCQMS-STRCPTL 320
>ALA2_ARATH (P98205) Putative phospholipid-transporting ATPase 2 (EC 3.6.3.1)| (Aminophospholipid flippase 2) Length = 1107 Score = 27.3 bits (59), Expect = 9.5 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -2 Query: 226 QYFLIFNCLIFWLIISPYSAVET 158 QYFL+ CL W +I+P + T Sbjct: 47 QYFLLIACLQLWSLITPVNPAST 69 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,258,282 Number of Sequences: 219361 Number of extensions: 832913 Number of successful extensions: 1956 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1868 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1956 length of database: 80,573,946 effective HSP length: 92 effective length of database: 60,392,734 effective search space used: 1449425616 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)