| Clone Name | rbaet23e02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | T257_ECOLI (P25239) Type IIS restriction enzyme Eco57I (EC 3.1.2... | 29 | 4.4 |
|---|
>T257_ECOLI (P25239) Type IIS restriction enzyme Eco57I (EC 3.1.21.4)| (Endonuclease Eco57I) [Includes: Adenine-specific methyltransferase activity Eco57IA (EC 2.1.1.72) (M.Eco57IA)] Length = 998 Score = 29.3 bits (64), Expect = 4.4 Identities = 20/60 (33%), Positives = 31/60 (51%), Gaps = 1/60 (1%) Frame = +1 Query: 52 ERKEYIESKKKRIDILTGSKSQLAVKSINTA*KIKCSFF-K*QTTVIATRNSQ*KETSCI 228 ERK ++E+KK +DI T + L V+ K+K S + T I ++Q KET + Sbjct: 86 ERKFFLEAKKPSVDISTTIEPALQVRRYGFTAKLKISVLSNFEYTAIYDCSNQVKETDSV 145 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,980,647 Number of Sequences: 219361 Number of extensions: 1109706 Number of successful extensions: 2199 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2173 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2199 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2570413340 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)