| Clone Name | rbaet22f03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ENH3_HUMAN (Q9N2J8) HERV-H_2q24.1 provirus ancestral Env polypro... | 29 | 2.8 | 2 | NUGC_ANTFO (Q85BB2) NAD(P)H-quinone oxidoreductase chain J, chlo... | 28 | 6.3 |
|---|
>ENH3_HUMAN (Q9N2J8) HERV-H_2q24.1 provirus ancestral Env polyprotein precursor| (Envelope polyprotein) (Env protein HERV-H/p59) (HERV-H/env59) [Contains: Surface protein (SU); Transmembrane protein (TM)] Length = 555 Score = 29.3 bits (64), Expect = 2.8 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +2 Query: 113 SSFATRRL*PVQEIAYYIYRTNNGDADASHEPTA 214 +SF + L P +E+ Y++ R++ D SH+P A Sbjct: 96 TSFNSPHLYPPEELIYFLDRSSKTSPDISHQPAA 129
>NUGC_ANTFO (Q85BB2) NAD(P)H-quinone oxidoreductase chain J, chloroplast (EC| 1.6.5.-) (NAD(P)H dehydrogenase, chain J) (NADH-plastoquinone oxidoreductase subunit J) Length = 169 Score = 28.1 bits (61), Expect = 6.3 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -2 Query: 87 FDSRKDVLIESAFWLWTFAEHHENKS 10 F SRK+ I S FW+W A+ E +S Sbjct: 100 FVSRKNPKIPSVFWVWKGADFQERES 125 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,465,298 Number of Sequences: 219361 Number of extensions: 568971 Number of successful extensions: 1158 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1134 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1158 length of database: 80,573,946 effective HSP length: 55 effective length of database: 68,509,091 effective search space used: 1644218184 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)