| Clone Name | rbaet22a06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | FA57B_MOUSE (Q7TNV1) Protein FAM57B | 28 | 4.2 | 2 | KHSE_ENTFA (Q831T0) Homoserine kinase (EC 2.7.1.39) (HSK) (HK) | 28 | 5.5 | 3 | MURI_PEDPE (Q08783) Glutamate racemase (EC 5.1.1.3) | 27 | 9.3 | 4 | RP1L1_MOUSE (Q8CGM2) Retinitis pigmentosa 1-like 1 protein (Reti... | 27 | 9.3 | 5 | CO4A1_DROME (P08120) Collagen alpha-1(IV) chain precursor | 27 | 9.3 |
|---|
>FA57B_MOUSE (Q7TNV1) Protein FAM57B| Length = 225 Score = 28.5 bits (62), Expect = 4.2 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = -3 Query: 148 DGGRR*ILFCWGVVRSHLSMMVL*ILHHTPMCELC 44 DG R + W VVR +L L +LHH M +C Sbjct: 59 DGTPRALGSTWAVVRGYLHKEFLMVLHHAAMVLVC 93
>KHSE_ENTFA (Q831T0) Homoserine kinase (EC 2.7.1.39) (HSK) (HK)| Length = 287 Score = 28.1 bits (61), Expect = 5.5 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -3 Query: 112 VVRSHLSMMVL*ILHHTPMCELCRSLP 32 VV SH+ V + HH PMC++ +P Sbjct: 134 VVASHVENQVYHVKHHFPMCDVIAFIP 160
>MURI_PEDPE (Q08783) Glutamate racemase (EC 5.1.1.3)| Length = 265 Score = 27.3 bits (59), Expect = 9.3 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -2 Query: 146 RGQKIDPLLLGCRSFPSLHDG 84 R +ID L+LGC FP L +G Sbjct: 173 RQDQIDTLILGCTHFPLLEEG 193
>RP1L1_MOUSE (Q8CGM2) Retinitis pigmentosa 1-like 1 protein (Retinitis| pigmentosa 1-like protein 1) Length = 1859 Score = 27.3 bits (59), Expect = 9.3 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +3 Query: 51 SHMGVW*SIYRTIMERWERTTPQQKRIYLLPPSTDGQDHQR 173 +HMG+ YR WE + + R+ L+P + QD QR Sbjct: 597 NHMGLQTEKYRQGTRGWEVSGEPELRLALVPGHSGSQDTQR 637
>CO4A1_DROME (P08120) Collagen alpha-1(IV) chain precursor| Length = 1775 Score = 27.3 bits (59), Expect = 9.3 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = +2 Query: 77 LQDHHGEMGTNDTPAEEDLSSAPVHGRTGSP 169 L+ G GT P E+ L VHGR G P Sbjct: 1074 LRGDTGPAGTPGWPGEKGLPGLAVHGRAGPP 1104 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,078,258 Number of Sequences: 219361 Number of extensions: 625619 Number of successful extensions: 1634 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1571 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1634 length of database: 80,573,946 effective HSP length: 97 effective length of database: 59,295,929 effective search space used: 1423102296 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)