| Clone Name | rbaet21g11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TIP22_ORYSA (Q5Z6F0) Probable aquaporin TIP2.2 (Tonoplast intrin... | 44 | 8e-05 | 2 | YP66_CAEEL (Q09215) Hypothetical protein B0495.6 | 28 | 4.5 |
|---|
>TIP22_ORYSA (Q5Z6F0) Probable aquaporin TIP2.2 (Tonoplast intrinsic protein| 2.2) (OsTIP2.2) Length = 248 Score = 44.3 bits (103), Expect = 8e-05 Identities = 17/36 (47%), Positives = 23/36 (63%) Frame = -2 Query: 305 IWIYWXXXXXXXXXXXIVYRYLYMCDNHTPVASNDY 198 IWIYW +VYRY+YMC +H PVAS+++ Sbjct: 213 IWIYWVGPLVGGGLAGLVYRYVYMCGDHAPVASSEF 248
>YP66_CAEEL (Q09215) Hypothetical protein B0495.6| Length = 87 Score = 28.5 bits (62), Expect = 4.5 Identities = 21/68 (30%), Positives = 31/68 (45%), Gaps = 8/68 (11%) Frame = +2 Query: 8 HIILQIEKHASSKCYNFTGLRSEPNNMTFFTSSRH------SDHHARTFLCC--RRHHGN 163 H++ Q+E H SK Y T +R EP+ M ++ RH S + + C R N Sbjct: 9 HVLAQLE-HLQSK-YTGTAMRHEPSRMDCESAPRHSRLSNVSSRNEHVYCRCGEREPSSN 66 Query: 164 QAPNDPSH 187 +D SH Sbjct: 67 PLQSDKSH 74 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,655,352 Number of Sequences: 219361 Number of extensions: 705108 Number of successful extensions: 1492 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1472 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1492 length of database: 80,573,946 effective HSP length: 77 effective length of database: 63,683,149 effective search space used: 1528395576 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)