| Clone Name | rbaet21g07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | POLG_RTSVT (Q91PP5) Genome polyprotein [Contains: Putative leade... | 28 | 6.6 |
|---|
>POLG_RTSVT (Q91PP5) Genome polyprotein [Contains: Putative leader protein; Coat| protein 1 (25 kDa protein) (CP-1); Coat protein 2 (26 kDa protein) (CP-2); Coat protein 3 (35 kDa protein) (CP-3); Putative helicase (EC 3.6.1.-) (Putative NTP-binding protei Length = 3471 Score = 28.1 bits (61), Expect = 6.6 Identities = 17/45 (37%), Positives = 19/45 (42%) Frame = -3 Query: 179 IGVVNAWACVPTQLPSIAKGIHIACKPLCYRLHWQAGFLAAAGQR 45 I + A VPT GIH L YR+H GF AA R Sbjct: 2770 IELTEANVSVPTSYYEANGGIHTIISGLRYRVHCMPGFCGAAIMR 2814 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,754,269 Number of Sequences: 219361 Number of extensions: 489781 Number of successful extensions: 1279 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1265 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1279 length of database: 80,573,946 effective HSP length: 40 effective length of database: 71,799,506 effective search space used: 1723188144 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)