| Clone Name | rbaet19h04 |
|---|---|
| Clone Library Name | barley_pub |
>RHG06_HUMAN (O43182) Rho-GTPase-activating protein 6 (Rho-type| GTPase-activating protein RhoGAPX-1) Length = 974 Score = 29.3 bits (64), Expect = 2.4 Identities = 14/26 (53%), Positives = 16/26 (61%), Gaps = 2/26 (7%) Frame = -2 Query: 357 PGTPASC--WWTGPPERVTTPTARTG 286 PG PA+ W GPPE V TPT + G Sbjct: 887 PGKPAAAAAWIQGPPEGVETPTDQGG 912
>CO9A2_MOUSE (Q07643) Collagen alpha-2(IX) chain precursor| Length = 688 Score = 28.9 bits (63), Expect = 3.2 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = +2 Query: 296 AVGVVTRSGGPVHQQLAGVPG 358 + G V R G P HQ LAGVPG Sbjct: 319 SAGQVGRPGSPGHQGLAGVPG 339
>PRDM1_MOUSE (Q60636) PR domain zinc finger protein 1 (PR domain-containing| protein 1) (Beta-interferon gene positive-regulatory domain I-binding factor) (BLIMP-1) Length = 856 Score = 28.5 bits (62), Expect = 4.1 Identities = 17/35 (48%), Positives = 20/35 (57%) Frame = -1 Query: 373 GKGAYPGYAGQLLVDGATGASYNAHGAHGRKYLLP 269 G G+YPGYA + A SYNAH K+LLP Sbjct: 417 GLGSYPGYAPAPHLPPAFIPSYNAHYP---KFLLP 448
>BETT_ECOLI (P0ABC9) High-affinity choline transport protein| Length = 677 Score = 28.5 bits (62), Expect = 4.1 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = +1 Query: 106 IYTYMHYSTTSCTQYSLARWAASGFDSLHLSLPLCRRTSPTPAWSRR 246 ++T HY T + Y+L A G+ S +LPL R++ P + +R Sbjct: 140 VWTLFHYGLTGWSMYALMGMAL-GYFSYRYNLPLTIRSALYPIFGKR 185
>BETT_ECO57 (P0ABD0) High-affinity choline transport protein| Length = 677 Score = 28.5 bits (62), Expect = 4.1 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = +1 Query: 106 IYTYMHYSTTSCTQYSLARWAASGFDSLHLSLPLCRRTSPTPAWSRR 246 ++T HY T + Y+L A G+ S +LPL R++ P + +R Sbjct: 140 VWTLFHYGLTGWSMYALMGMAL-GYFSYRYNLPLTIRSALYPIFGKR 185
>PRDM1_HUMAN (O75626) PR domain zinc finger protein 1 (PR domain-containing| protein 1) (Beta-interferon gene positive-regulatory domain I-binding factor) (BLIMP-1) (Positive regulatory domain I-binding factor 1) (PRDI-binding factor 1) (PRDI-BF1) Length = 789 Score = 28.1 bits (61), Expect = 5.4 Identities = 17/35 (48%), Positives = 20/35 (57%) Frame = -1 Query: 373 GKGAYPGYAGQLLVDGATGASYNAHGAHGRKYLLP 269 G G+YPGYA + A SYNAH K+LLP Sbjct: 349 GLGSYPGYAPLPHLPPAFIPSYNAHYP---KFLLP 380
>SYK_RICPR (Q9ZDF8) Lysyl-tRNA synthetase (EC 6.1.1.6) (Lysine--tRNA ligase)| (LysRS) Length = 528 Score = 27.3 bits (59), Expect = 9.2 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = +3 Query: 63 YLAREDPNTSSYTNYLHVYALQYY 134 Y + PNTS+Y ++L +A++YY Sbjct: 403 YEPKATPNTSTYLDHLTEFAIRYY 426 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,032,107 Number of Sequences: 219361 Number of extensions: 839431 Number of successful extensions: 2259 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2200 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2259 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 1402043640 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)