| Clone Name | rbaet19b08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ATM_CANGA (Q6FRZ9) Serine/threonine-protein kinase TEL1 (EC 2.7.... | 28 | 8.3 | 2 | LEPA_ANASP (Q8YU48) GTP-binding protein lepA | 28 | 8.3 |
|---|
>ATM_CANGA (Q6FRZ9) Serine/threonine-protein kinase TEL1 (EC 2.7.11.1)| (DNA-damage checkpoint kinase TEL1) (Telomere length regulation protein 1) (ATM homolog) Length = 2763 Score = 27.7 bits (60), Expect = 8.3 Identities = 17/67 (25%), Positives = 36/67 (53%), Gaps = 3/67 (4%) Frame = -2 Query: 216 HTHTYI*INALIYYLHVGEKERERSTYVEPAMHGR--HTVVSML*LIFTSFERNREFV-V 46 H+ Y +LIY+++ EK + TY+ ++ R ++ + L F +E ++F+ + Sbjct: 679 HSLKYTFAISLIYFINFIEKSGKVYTYLNQELNQRLNSILIELDFLSFDKWEEGKQFIEI 738 Query: 45 LCSMCTF 25 +C+ TF Sbjct: 739 ICNQETF 745
>LEPA_ANASP (Q8YU48) GTP-binding protein lepA| Length = 603 Score = 27.7 bits (60), Expect = 8.3 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = -1 Query: 232 EVIYTTHTHIYMNKCSHILSPCGRERKREKYVR 134 +VI T +Y++ SH+ +P RER E YV+ Sbjct: 378 KVITTKGEELYIDNPSHLPAPNDRERIEEPYVK 410 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,199,727 Number of Sequences: 219361 Number of extensions: 575153 Number of successful extensions: 1232 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1223 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1232 length of database: 80,573,946 effective HSP length: 53 effective length of database: 68,947,813 effective search space used: 1654747512 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)