| Clone Name | rbaet18e09 |
|---|---|
| Clone Library Name | barley_pub |
>LYAM2_PIG (P98110) E-selectin precursor (Endothelial leukocyte adhesion| molecule 1) (ELAM-1) (Leukocyte-endothelial cell adhesion molecule 2) (LECAM2) (CD62E antigen) Length = 484 Score = 33.9 bits (76), Expect = 0.11 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = +3 Query: 27 KQYLCLWLAATPTPTSVHAKCLQTFNITPIQMVPG 131 K LC A TPT S H +C++T N + Q PG Sbjct: 135 KLALCYTAACTPTSCSGHGECIETINSSTCQCYPG 169
>LYAM2_BOVIN (P98107) E-selectin precursor (Endothelial leukocyte adhesion| molecule 1) (ELAM-1) (Leukocyte-endothelial cell adhesion molecule 2) (LECAM2) (CD62E antigen) Length = 485 Score = 30.8 bits (68), Expect = 0.91 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = +3 Query: 27 KQYLCLWLAATPTPTSVHAKCLQTFNITPIQMVPG 131 K LC A PTP H +C++T N Q PG Sbjct: 135 KLALCYKAACNPTPCGSHGECVETINNYTCQCHPG 169
>LYAM2_CANFA (P33730) E-selectin precursor (Endothelial leukocyte adhesion| molecule 1) (ELAM-1) (Leukocyte-endothelial cell adhesion molecule 2) (LECAM2) (CD62E antigen) Length = 611 Score = 29.3 bits (64), Expect = 2.6 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = +3 Query: 27 KQYLCLWLAATPTPTSVHAKCLQTFNITPIQMVPG 131 K LC A TPT S H +C++T N + PG Sbjct: 135 KLALCYTAACTPTSCSGHGECVETVNNYTCKCHPG 169
>CCA1_SCHPO (Q9UTQ0) Probable tRNA nucleotidyltransferase (EC 2.7.7.25) (tRNA| adenylyltransferase) (tRNA CCA-pyrophosphorylase) (CCA-adding enzyme) Length = 500 Score = 28.5 bits (62), Expect = 4.5 Identities = 21/76 (27%), Positives = 34/76 (44%) Frame = +3 Query: 66 PTSVHAKCLQTFNITPIQMVPGA*PVMLLLILSDRNIYNIASCN*LKLG*RFRLPKLSWY 245 P +H K LQ+ NI + ++P A + L D +I N++S + K + L WY Sbjct: 265 PLEIHTKKLQSKNIESLSLIPYAIDLFGYLQKKDVSIKNLSSSS--KYIFWLAIATLPWY 322 Query: 246 QKNINWNTTNDPNIHL 293 NW+ I + Sbjct: 323 ----NWSILEKSKIKI 334
>7UP2_DROME (P16376) Steroid receptor seven-up, isoform A| Length = 746 Score = 28.1 bits (61), Expect = 5.9 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 33 YLCLWLAATPTPTSVHAKCLQTFNITPIQMV 125 Y+ L L A P PTS + +C+Q NI I + Sbjct: 311 YISLLLRAEPYPTSRYGQCMQPNNIMGIDNI 341
>7UP1_DROME (P16375) Steroid receptor seven-up, isoforms B/C| Length = 543 Score = 28.1 bits (61), Expect = 5.9 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 33 YLCLWLAATPTPTSVHAKCLQTFNITPIQMV 125 Y+ L L A P PTS + +C+Q NI I + Sbjct: 311 YISLLLRAEPYPTSRYGQCMQPNNIMGIDNI 341
>LYAM2_HORSE (Q95LG1) E-selectin precursor (Endothelial leukocyte adhesion| molecule 1) (ELAM-1) (Leukocyte-endothelial cell adhesion molecule 2) (LECAM2) (CD62E antigen) Length = 610 Score = 27.7 bits (60), Expect = 7.7 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = +3 Query: 27 KQYLCLWLAATPTPTSVHAKCLQTFNITPIQMVPG 131 K LC A T T S H +C++T N Q PG Sbjct: 133 KLALCYTAACTHTSCSGHGECVETINNYTCQCHPG 167 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,589,705 Number of Sequences: 219361 Number of extensions: 814175 Number of successful extensions: 2053 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2008 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2053 length of database: 80,573,946 effective HSP length: 76 effective length of database: 63,902,510 effective search space used: 1533660240 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)