| Clone Name | rbaet17f12 |
|---|---|
| Clone Library Name | barley_pub |
>PLXA1_MOUSE (P70206) Plexin-A1 precursor (Plexin-1) (Plex 1)| Length = 1894 Score = 30.0 bits (66), Expect = 1.5 Identities = 16/62 (25%), Positives = 30/62 (48%), Gaps = 2/62 (3%) Frame = +2 Query: 62 APRKMYTYGEETRSIERITNVPCVRTFACVICMASAVRRRTYVRTCLL--LCSYLDTGER 235 +P + Y Y + + ++ CV+ +C +C+ S R + C+L +CS D ER Sbjct: 491 SPNRQYLYAMTEKQVTQVPVESCVQYTSCELCLGS---RDPHCGWCVLHSICSRQDACER 547 Query: 236 PQ 241 + Sbjct: 548 AE 549
>PLXA1_HUMAN (Q9UIW2) Plexin-A1 precursor (Semaphorin receptor NOV)| Length = 1896 Score = 30.0 bits (66), Expect = 1.5 Identities = 17/60 (28%), Positives = 28/60 (46%), Gaps = 2/60 (3%) Frame = +2 Query: 62 APRKMYTYGEETRSIERITNVPCVRTFACVICMASAVRRRTYVRTCLL--LCSYLDTGER 235 +P Y Y + + R+ CV+ +C +C+ S R + C+L +CS D ER Sbjct: 493 SPNHQYLYAMTEKQVTRVPVESCVQYTSCELCLGS---RDPHCGWCVLHSICSRRDACER 549
>MLL2_HUMAN (O14686) Myeloid/lymphoid or mixed-lineage leukemia protein 2| (ALL1-related protein) Length = 5262 Score = 30.0 bits (66), Expect = 1.5 Identities = 21/69 (30%), Positives = 31/69 (44%) Frame = +2 Query: 110 RITNVPCVRTFACVICMASAVRRRTYVRTCLLLCSYLDTGERPQIHNNLKCFLSLPAASK 289 +IT V ++ + CV C+ V + + LLLC D I + C L P + Sbjct: 1137 KITKVMLLKGWRCVECIVCEVCGQASDPSRLLLCDDCD------ISYHTYC-LDPPLLTV 1189 Query: 290 PGGGLRCSW 316 P GG +C W Sbjct: 1190 PKGGWKCKW 1198
>POLG_EC11G (P29813) Genome polyprotein [Contains: Coat protein VP4 (P1A); Coat| protein VP2 (P1B); Coat protein VP3 (P1C); Coat protein VP1 (P1D); Picornain 2A (EC 3.4.22.29) (Core protein P2A); Core protein P2B; Core protein P2C; Core protein P3A; Genome Length = 2194 Score = 29.6 bits (65), Expect = 2.0 Identities = 13/41 (31%), Positives = 23/41 (56%) Frame = -3 Query: 194 YVRTYDDALHLPCISRMQTYARMEHLLFFRWIGSPPRMCTF 72 YVR + + LP S ++ Y + +H+ W+ PPR+C + Sbjct: 788 YVRHVNGSSPLPMTSTVRMYFKPKHVK--AWVPRPPRLCQY 826
>POLG_CXB5P (Q03053) Genome polyprotein [Contains: Coat protein VP4 (P1A); Coat| protein VP2 (P1B); Coat protein VP3 (P1C); Coat protein VP1 (P1D); Picornain 2A (EC 3.4.22.29) (Core protein P2A); Core protein P2B; Core protein P2C; Core protein P3A; Genome Length = 2184 Score = 29.3 bits (64), Expect = 2.6 Identities = 12/41 (29%), Positives = 23/41 (56%) Frame = -3 Query: 194 YVRTYDDALHLPCISRMQTYARMEHLLFFRWIGSPPRMCTF 72 Y+R +D P +S ++ Y + +H+ W+ PPR+C + Sbjct: 786 YMRHVNDGSPGPIVSTVRIYFKPKHVK--TWVPRPPRLCQY 824
>POLG_SVDVU (P13900) Genome polyprotein [Contains: Coat protein VP4 (P1A); Coat| protein VP2 (P1B); Coat protein VP3 (P1C); Coat protein VP1 (P1D); Picornain 2A (EC 3.4.22.29) (Core protein P2A) (P2-3B); Core protein P2B (P2-5B); Core protein P2C (P2-X); C Length = 2184 Score = 28.5 bits (62), Expect = 4.4 Identities = 12/41 (29%), Positives = 23/41 (56%) Frame = -3 Query: 194 YVRTYDDALHLPCISRMQTYARMEHLLFFRWIGSPPRMCTF 72 Y+R +D P +S ++ Y + +H+ W+ PPR+C + Sbjct: 786 YMRHVNDGGPGPIVSTVRIYFKPKHVK--TWVPRPPRLCQY 824
>POLG_SVDVH (P16604) Genome polyprotein [Contains: Coat protein VP4 (P1A); Coat| protein VP2 (P1B); Coat protein VP3 (P1C); Coat protein VP1 (P1D); Picornain 2A (EC 3.4.22.29) (Core protein P2A) (P2-3B); Core protein P2B (P2-5B); Core protein P2C (P2-X); C Length = 2184 Score = 28.5 bits (62), Expect = 4.4 Identities = 12/41 (29%), Positives = 23/41 (56%) Frame = -3 Query: 194 YVRTYDDALHLPCISRMQTYARMEHLLFFRWIGSPPRMCTF 72 Y+R +D P +S ++ Y + +H+ W+ PPR+C + Sbjct: 786 YMRHVNDGGPGPIVSTVRIYFKPKHVK--TWVPRPPRLCQY 824
>POLG_EC06C (Q66474) Genome polyprotein [Contains: Coat protein VP4 (P1A); Coat| protein VP2 (P1B); Coat protein VP3 (P1C); Coat protein VP1 (P1D); Picornain 2A (EC 3.4.22.29) (Core protein P2A); Core protein P2B; Core protein P2C; Core protein P3A; Genome Length = 2190 Score = 28.5 bits (62), Expect = 4.4 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = -3 Query: 194 YVRTYDDALHLPCISRMQTYARMEHLLFFRWIGSPPRMCTF 72 Y R +D P S+++ Y + +H+ W+ PPR+C + Sbjct: 787 YFRHVNDRTISPITSKVRIYFKPKHVK--AWVPRPPRLCEY 825
>POLG_EC09H (Q66849) Genome polyprotein [Contains: Coat protein VP4 (P1A); Coat| protein VP2 (P1B); Coat protein VP3 (P1C); Coat protein VP1 (P1D); Picornain 2A (EC 3.4.22.29) (Core protein P2A); Core protein P2B; Core protein P2C; Core protein P3A; Genome Length = 2192 Score = 28.1 bits (61), Expect = 5.7 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = -2 Query: 207 KSKHVRTYVRRRTALAMHITHANVRTHGTFVILSMDRVSS 88 K KHVR +V R L ++ ANV T V + D +++ Sbjct: 809 KPKHVRAWVPRPPRLCQYMNKANVNFEATAVTDTRDTINT 848
>IFRD1_MOUSE (P19182) Interferon-related developmental regulator 1 (Nerve growth| factor-inducible protein PC4) (TPA-induced sequence 7) (TIS7 protein) Length = 449 Score = 28.1 bits (61), Expect = 5.7 Identities = 11/40 (27%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = +2 Query: 149 VICM-ASAVRRRTYVRTCLLLCSYLDTGERPQIHNNLKCF 265 +IC A++++ R TC +C ++ T + ++++ L+CF Sbjct: 174 IICDGAASIQARQTCATCFGVCCFIATDDITELYSTLECF 213
>NUOA_BUCBP (Q89AU6) NADH-quinone oxidoreductase chain A (EC 1.6.99.5) (NADH| dehydrogenase I, chain A) (NDH-1, chain A) Length = 132 Score = 28.1 bits (61), Expect = 5.7 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = -1 Query: 67 WGFLAFFFVVIKTCVIMIRL 8 W F FFF+ + CV M+ + Sbjct: 12 WAFFTFFFIAVSICVFMLSI 31
>WDR24_BRARE (Q7ZVL2) WD-repeat protein 24| Length = 779 Score = 27.3 bits (59), Expect = 9.8 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = +2 Query: 101 SIERITNVPCVRTFACVICMASAVRRRTYVRTCLLLCSY 217 S R+ + CV+TFA V + RR ++ TC ++ + Sbjct: 232 STNRVKEIYCVQTFASVARVKWRPERRYHLATCSMMVDH 270 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,834,771 Number of Sequences: 219361 Number of extensions: 979932 Number of successful extensions: 2159 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 2139 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2159 length of database: 80,573,946 effective HSP length: 84 effective length of database: 62,147,622 effective search space used: 1491542928 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)