| Clone Name | rbaet17e07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MUSK_CHICK (Q8AXY6) Muscle, skeletal receptor tyrosine protein k... | 31 | 0.99 | 2 | ZDH17_MOUSE (Q80TN5) Palmitoyltransferase ZDHHC17 (EC 2.3.1.-) (... | 28 | 6.4 | 3 | ZDH17_HUMAN (Q8IUH5) Palmitoyltransferase ZDHHC17 (EC 2.3.1.-) (... | 28 | 8.4 | 4 | UPPP2_CLOAB (Q97KF6) Undecaprenyl-diphosphatase 2 (EC 3.6.1.27) ... | 28 | 8.4 |
|---|
>MUSK_CHICK (Q8AXY6) Muscle, skeletal receptor tyrosine protein kinase| precursor (EC 2.7.10.1) (Muscle-specific tyrosine protein kinase receptor) (Muscle-specific kinase receptor) (MuSK) Length = 947 Score = 30.8 bits (68), Expect = 0.99 Identities = 24/61 (39%), Positives = 29/61 (47%), Gaps = 6/61 (9%) Frame = +1 Query: 1 VFFPRS----E*SAEILVHTKSTELATPTNAQQNKCNDTTKNH--HSCKSSTVG*ADKKT 162 VFF S E + E+LVHT TEL T ++ Q N+ CK S VG A K Sbjct: 335 VFFNSSYADPEETQELLVHTAWTELKTVSSFCQPAAESLLCNYIFQECKPSGVGPAPKPI 394 Query: 163 C 165 C Sbjct: 395 C 395
>ZDH17_MOUSE (Q80TN5) Palmitoyltransferase ZDHHC17 (EC 2.3.1.-) (Zinc finger| DHHC domain-containing protein 17) (DHHC-17) (Huntingtin-interacting protein 14) Length = 632 Score = 28.1 bits (61), Expect = 6.4 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = -3 Query: 202 CTGIKNRRFGMLDMFFCQLILR*MICSCGGFWWCRC 95 C G N R+ M +FF ++ MI C +W C Sbjct: 473 CVGAGNHRYFMGYLFFLLFMICWMIYGCVSYWGLHC 508
>ZDH17_HUMAN (Q8IUH5) Palmitoyltransferase ZDHHC17 (EC 2.3.1.-) (Zinc finger| DHHC domain-containing protein 17) (DHHC-17) (Huntingtin-interacting protein 14) (Huntingtin-interacting protein 3) (Huntingtin-interacting protein HYPH) (Putative NF-kappa-B-act Length = 632 Score = 27.7 bits (60), Expect = 8.4 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = -3 Query: 202 CTGIKNRRFGMLDMFFCQLILR*MICSCGGFWWCRC 95 C G N R+ M +FF ++ MI C +W C Sbjct: 473 CVGAGNHRYFMGYLFFLLFMICWMIYGCISYWGLHC 508
>UPPP2_CLOAB (Q97KF6) Undecaprenyl-diphosphatase 2 (EC 3.6.1.27) (Undecaprenyl| pyrophosphate phosphatase 2) (Bacitracin resistance protein 2) Length = 307 Score = 27.7 bits (60), Expect = 8.4 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -2 Query: 194 HKKSAIRHVGHVFLSAYPTVDDLQLWWFLVVS 99 H+KS I VG F+ Y T+ + W +VV+ Sbjct: 95 HEKSGIGVVGEFFVKGYNTMPGFKFWTNIVVA 126 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,524,482 Number of Sequences: 219361 Number of extensions: 607842 Number of successful extensions: 1482 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1455 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1482 length of database: 80,573,946 effective HSP length: 51 effective length of database: 69,386,535 effective search space used: 1665276840 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)