| Clone Name | rbaet16e10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CRD1_CHLRE (Q9LD46) Magnesium-protoporphyrin IX monomethyl ester... | 29 | 2.5 | 2 | SRP54_METJA (Q57565) Signal recognition 54 kDa protein (SRP54) | 28 | 7.3 | 3 | VMSA_HBVW2 (P03141) Major surface antigen precursor | 27 | 9.6 |
|---|
>CRD1_CHLRE (Q9LD46) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase 1, chloroplast precursor (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase 1) (Copper response defect 1 protein) (Copper-response target 1 protein Length = 407 Score = 29.3 bits (64), Expect = 2.5 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = +3 Query: 105 KPLKLIHSTTKEGEDGHGDYLTCERHLQLNPRKQ 206 KP +I++T + G+ Y+T RHLQ NP Q Sbjct: 206 KPKFIIYATFLSEKIGYWRYITIYRHLQRNPDNQ 239
>SRP54_METJA (Q57565) Signal recognition 54 kDa protein (SRP54)| Length = 451 Score = 27.7 bits (60), Expect = 7.3 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = +3 Query: 177 RHLQLNPRKQNLVLLITLVQSTNITS 254 + L+LNP+KQN++LL+ + S T+ Sbjct: 91 KKLELNPKKQNVILLVGIQGSGKTTT 116
>VMSA_HBVW2 (P03141) Major surface antigen precursor| Length = 399 Score = 27.3 bits (59), Expect = 9.6 Identities = 17/43 (39%), Positives = 22/43 (51%), Gaps = 5/43 (11%) Frame = +3 Query: 225 TLVQSTNITSHIWFCGVSTSDRLSR-----SSFLGPVLVSQFG 338 T+ + NI SHI T D ++ S FLGP+LV Q G Sbjct: 149 TVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAG 191 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,911,383 Number of Sequences: 219361 Number of extensions: 842890 Number of successful extensions: 1732 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1709 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1732 length of database: 80,573,946 effective HSP length: 90 effective length of database: 60,831,456 effective search space used: 1459954944 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)