| Clone Name | rbaet16e03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SALL4_HUMAN (Q9UJQ4) Sal-like protein 4 (Zinc finger protein SALL4) | 29 | 3.7 | 2 | PPO_MALDO (P43309) Polyphenol oxidase, chloroplast precursor (EC... | 28 | 6.4 | 3 | GIS4_YEAST (Q04233) Protein GIS4 | 28 | 8.3 | 4 | AFAM_MOUSE (O89020) Afamin precursor (Alpha-albumin) (Alpha-Alb) | 28 | 8.3 |
|---|
>SALL4_HUMAN (Q9UJQ4) Sal-like protein 4 (Zinc finger protein SALL4)| Length = 1053 Score = 28.9 bits (63), Expect = 3.7 Identities = 12/45 (26%), Positives = 26/45 (57%), Gaps = 2/45 (4%) Frame = +3 Query: 15 MNRHNKNEKGNKDSGSEEKIRKEITHIC--ICYQKNDLSVFILHR 143 +N +E ++D + +++R+E TH+C C + +S F+ H+ Sbjct: 47 VNHPGNDEVASEDEATVKRLRREETHVCEKCCAEFFSISEFLEHK 91
>PPO_MALDO (P43309) Polyphenol oxidase, chloroplast precursor (EC 1.10.3.1)| (PPO) (Catechol oxidase) Length = 593 Score = 28.1 bits (61), Expect = 6.4 Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Frame = -1 Query: 114 FFDSIYIYV*FP-F*FSPHSRYLCFPFHFYYVY 19 + D Y V FP H+ +L FPFH YY+Y Sbjct: 178 YCDGAYDQVGFPELELQIHNSWLFFPFHRYYLY 210
>GIS4_YEAST (Q04233) Protein GIS4| Length = 774 Score = 27.7 bits (60), Expect = 8.3 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +3 Query: 12 TMNRHNKNEKGNKDSGSEEKIRK 80 T N H N KGN +S S+ +++K Sbjct: 682 TKNSHKPNSKGNNESNSKNELKK 704
>AFAM_MOUSE (O89020) Afamin precursor (Alpha-albumin) (Alpha-Alb)| Length = 611 Score = 27.7 bits (60), Expect = 8.3 Identities = 15/43 (34%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Frame = +1 Query: 43 ETKIAGVRRKSERKLHIYVYAI-KKMIFLFSFYIEAT*AWL*E 168 E K + KSE LH+Y+Y + ++ F+F+ + A AW E Sbjct: 145 EEKCQAYKNKSESFLHLYMYEVARRNPFVFAPVLLAVAAWFEE 187 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 24,738,134 Number of Sequences: 219361 Number of extensions: 335395 Number of successful extensions: 931 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 917 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 930 length of database: 80,573,946 effective HSP length: 52 effective length of database: 69,167,174 effective search space used: 1660012176 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)